KEGG   Aromatoleum aromaticum: ebA6378Help
Entry
ebA6378           CDS       T00222                                 

Gene name
epsT
Definition
UDP-glucose pyrophosphorylase EpsT
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
eba  Aromatoleum aromaticum
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:eba00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ebA6378 (epsT)
   00052 Galactose metabolism
    ebA6378 (epsT)
   00500 Starch and sucrose metabolism
    ebA6378 (epsT)
   00520 Amino sugar and nucleotide sugar metabolism
    ebA6378 (epsT)
Enzymes [BR:eba01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     ebA6378 (epsT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3784275..3785147)
Genome map
AA seq 290 aa AA seqDB search
MKKVTKAVFPVAGMGTRFLPATKASPKEMLPIVDKPLIQYAVEEAVAAGITDMIFITGRT
KRSIEDHFDKAYELETELEARGKKEMLALVQRTVPKGVNCIYIRQSEALGLGHAVLCAAP
VIGDEAFAVILADDLLDNPDSASIMEQMVGVYNYNRCSVLGTMNVPREETRQYGIVSTEA
QQGDVQRVTGIIEKPKPEDAPTTQAVVGRYILTPRIFDHIRALQPGAGGEYQLTDAIAAL
LKDEAVLSYQFKGVRYDCGSKLGYLKATIELGLRHPEIGEEFAAYLAERS
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaagtcacgaaagcagtatttccggtagccggcatgggcacgcgctttttgccg
gcgaccaaggcgagcccgaaggagatgctgccgatcgtcgacaagccgctgatccagtac
gcggtcgaggaagccgtcgcggccgggattaccgacatgatcttcatcaccgggcgcacc
aagcgctcgatcgaggatcacttcgacaaggcctacgagctcgaaaccgagctcgaagcc
cgcggcaagaaggaaatgctcgcgctggtgcagcgcaccgtgccgaaaggcgtgaactgc
atctacatccgccagtcggaagcgctcgggctcggccacgcagtgctgtgcgccgcgccg
gtcatcggcgacgaagcgttcgcggtgatcctcgccgacgacctgctcgacaacccggac
tctgcctcgatcatggagcagatggtcggcgtctataactacaaccgctgttcggtgctc
ggtacgatgaacgtgccgcgtgaagagacgcgccagtacggcatcgtcagcaccgaagcg
cagcagggtgacgtgcagcgggtgaccgggatcatcgagaaacccaagcccgaagatgct
ccgacgacgcaagcggtcgtcggtcgctacatcctgacgccgcgcatcttcgaccacatc
cgcgcgctgcagccgggcgcgggtggcgaatatcagctgactgacgcgatcgccgcgttg
ctgaaggacgaggcggtgttgtcgtaccagttcaagggcgtgcgctacgactgcggctca
aagctgggctacctgaaagcgaccatcgaactcggcctgcgccatcccgaaatcggcgaa
gagtttgcggcgtatctggccgaacgaagctga

DBGET integrated database retrieval system