KEGG   Aromatoleum aromaticum: ebA6393Help
Entry
ebA6393           CDS       T00222                                 

Gene name
btuE
Definition
glutathione peroxidase protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
eba  Aromatoleum aromaticum
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:eba00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    ebA6393 (btuE)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    ebA6393 (btuE)
Enzymes [BR:eba01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     ebA6393 (btuE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3798101..3798589)
Genome map
AA seq 162 aa AA seqDB search
MSVPANVFDFETRRLNGAPMPLAEFRGKVLLLVNTASECGFTPQYEALQELHDRFAPRGF
SVIGFPCNQFGGQEPGGAEEIAAFCAKNYGVSFPLSEKIDVNGDNAHPLYRHLTSVAPGI
LGTEAIKWNFTKFLVDRDGQVVARFAPATKPESIARDIEALL
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtcccggcaaacgtgttcgatttcgaaaccaggcggctcaacggggcgccgatg
ccgctcgcggaatttcgcggcaaagtgctgctgctcgtcaataccgcgagcgaatgcggc
ttcacgccgcagtacgaggcactgcaggaactgcacgacaggttcgcaccgcgcggtttt
tcggtgatcggttttccgtgcaaccagttcggcgggcaggagccgggcggggctgaagaa
atcgctgcgttctgcgcgaagaactacggcgtcagcttcccgctcagcgaaaagatcgac
gtaaacggcgacaatgcgcatccactgtaccggcatctcacgtcggtcgcgcccggcatt
ctcggcaccgaagcgatcaagtggaacttcaccaagttcctggtcgatcgcgatggtcag
gtcgtcgcgcgtttcgccccggcgacgaaaccggaaagcatcgcacgcgatatcgaagcg
ctgctgtag

DBGET integrated database retrieval system