KEGG   Aromatoleum aromaticum EbN1: ebA6393Help
Entry
ebA6393           CDS       T00222                                 

Gene name
btuE
Definition
glutathione peroxidase protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
eba  Aromatoleum aromaticum EbN1
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:eba00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:eba00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3798101..3798589)
Genome map
AA seq 162 aa AA seqDB search
MSVPANVFDFETRRLNGAPMPLAEFRGKVLLLVNTASECGFTPQYEALQELHDRFAPRGF
SVIGFPCNQFGGQEPGGAEEIAAFCAKNYGVSFPLSEKIDVNGDNAHPLYRHLTSVAPGI
LGTEAIKWNFTKFLVDRDGQVVARFAPATKPESIARDIEALL
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtcccggcaaacgtgttcgatttcgaaaccaggcggctcaacggggcgccgatg
ccgctcgcggaatttcgcggcaaagtgctgctgctcgtcaataccgcgagcgaatgcggc
ttcacgccgcagtacgaggcactgcaggaactgcacgacaggttcgcaccgcgcggtttt
tcggtgatcggttttccgtgcaaccagttcggcgggcaggagccgggcggggctgaagaa
atcgctgcgttctgcgcgaagaactacggcgtcagcttcccgctcagcgaaaagatcgac
gtaaacggcgacaatgcgcatccactgtaccggcatctcacgtcggtcgcgcccggcatt
ctcggcaccgaagcgatcaagtggaacttcaccaagttcctggtcgatcgcgatggtcag
gtcgtcgcgcgtttcgccccggcgacgaaaccggaaagcatcgcacgcgatatcgaagcg
ctgctgtag

DBGET integrated database retrieval system