KEGG   Aromatoleum aromaticum: ebA6610Help
Entry
ebA6610           CDS       T00222                                 

Gene name
dsbC
Definition
periplasmic thiol:disulfide interchange protein (EC:5.3.4.1)
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
eba  Aromatoleum aromaticum
Brite
Enzymes [BR:eba01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     ebA6610 (dsbC)
Secretion system [BR:eba02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   ebA6610 (dsbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3919349..3920152
Genome map
AA seq 267 aa AA seqDB search
MATTEAVRGRLAAIALITAFAGAFPPALAATSDESRLLTALQKAHPGTRFTEVTRSPVAG
LFEVWMDGNVAYVPASAPRYFLFGRLFDTETLRDLTGPKLAQAARTSSPADSADVQTPIP
PVAFDQLPLGDAIKTVRGKGERRLAVFSDPNCPYCQQLEPELASLDNVTVYTFLVPFQGE
TKPIAVWCAADREQAWERLMLQGDETLLSPGATCDHPIARNLELARRLGVQGTPTLVWAD
GTRTEGFVGRTVLKARLAQAGIPERQP
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggcaactactgaagccgtgcgcggccgcctcgcggcgatcgcgctgatcacggcgttc
gcgggcgcattcccgccggcgctcgccgcgacgtctgacgaatcccgcctcctgaccgcc
ttgcagaaggcccatcccggcacgcgcttcaccgaggtcacgcgctccccggtggccggc
ctttttgaagtctggatggacggcaacgtcgcctacgtcccggcgagcgccccgcgctat
ttcctgttcggccggctgttcgacaccgagaccctgcgggacctcaccggcccgaagctg
gcgcaggccgcgcgcaccagcagcccggcagactctgccgacgtgcaaacgccaatccct
ccagttgccttcgaccagttgccgctgggcgatgcgatcaagacggtgcgcggcaagggc
gagcgccggctcgccgtcttcagcgatcccaactgcccctactgccagcagttggagccg
gagttggcgagcctcgacaacgtcaccgtctacaccttcctcgtgcccttccagggcgag
accaaaccgatcgcggtgtggtgtgcggccgatcgtgagcaggcctgggagcgcctgatg
ctccagggcgacgagacactcctcagccccggcgcaacctgcgaccaccccatcgcccgc
aacctggagttggcccgccgcctcggcgtgcaaggcacgcccaccctggtctgggcagat
ggcacgcgtacagaaggcttcgtggggcgcacggtattgaaggcgcgactcgcccaggcc
ggcatcccggagcggcaaccatga

DBGET integrated database retrieval system