KEGG   Aromatoleum aromaticum EbN1: ebA6814Help
Entry
ebA6814           CDS       T00222                                 

Definition
periplasmic lipid esterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
eba  Aromatoleum aromaticum EbN1
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:eba01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4044265..4044876
Genome map
AA seq 203 aa AA seqDB search
MLLRSIVIFFFAIMVSGAGQAATILVWGDSLSAGYGLRAKQDWPTLLQTRLEREGFRHTV
INGSVSGETSSGGRSRLPAALDRHEPDLLILELGANDGLRGLPPRLLAENLAAMIEAARS
RGTRVLLIGMQMPPNYGPPYRQRFEQTFADVAREHKVPLVPFLLDGFAERHEMFQSDGIH
PTAEAQELIVDTVWKQLAPMLKG
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgctgctgcgatccatcgtgatcttcttcttcgcaataatggtttcaggcgccgggcag
gcggcgacgatactggtgtggggcgacagcctctcggccggctacggcctgcgtgcgaag
caggactggcccaccctgctccagacgcgcctcgaacgcgaagggttccgccacacagtg
atcaacggcagcgtcagcggcgagacgtcctcgggcgggcgctcgcgcctgccggcggcg
ctcgaccgccacgaaccggacctgctgatcctcgaactcggcgccaacgacggcctgcgc
ggcctgccgccgcggctgctcgcggagaacctcgccgcgatgatcgaggccgcgcgcagc
cgtggcacccgcgtgctgctgatcggcatgcagatgccgccgaattacggccccccttac
aggcagcgcttcgagcagactttcgccgacgtcgcacgcgagcacaaggtgccgctggtg
ccgttcctgctcgacggcttcgccgagcgtcacgagatgttccagtccgacggcatccac
ccgacggccgaagcgcaggaactcatcgtcgacaccgtctggaagcagctcgcgccgatg
ctgaagggatag

DBGET integrated database retrieval system