KEGG   Aromatoleum aromaticum: ebA6832Help
Entry
ebA6832           CDS       T00222                                 

Definition
aldose 1-epimerase
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
eba  Aromatoleum aromaticum
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:eba00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ebA6832
Enzymes [BR:eba01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     ebA6832
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4052621..4053469
Genome map
AA seq 282 aa AA seqDB search
MTASIETRTFHDQPALVLRTPGGAQAVVSLLGAQVLSWTPAGGSEWLYLSPQARHDGSTP
IRGGIPVCFPQFAALGRLPKHGLVRTRRWTVGEQRSGDDFALVTLTTSEDDASYAAWPQR
FSAEITVIIEGERLGVELEVGNTGHAPFAFTAALHTYLRVGEVENARLEGLHGHEYRDAA
DNDRIKRDSGDALVVEAETDRVYHDVQRPLLLRDGGRSLGINVEGFPDVVVWNPWEQRCA
QMPDLPANGFRHMLCVEAAAARHRIELDAGEQWYGRQTLIAL
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcatccatcgaaacacgcactttccacgatcaacccgcgctcgtcctgcgcacg
ccgggcggcgcgcaggcggtcgtctcgctgctcggcgcccaggtgctgtcgtggacaccg
gccggcggcagcgagtggctgtacctcagtccgcaggcgcgccacgatggcagcacgccg
attcgcggcggcattccggtgtgctttccgcagttcgctgcgctcggcaggctgccgaag
cacggcctcgtgcgcacccggcggtggaccgtcggcgagcagcgcagcggcgacgacttc
gcgctggtgacgctgacgacgagcgaagacgatgcgagctacgcagcgtggccgcagcgc
ttctccgccgagatcacggtgatcatcgaaggcgagcgcctcggcgtcgagctggaagtc
gggaacaccggccacgcgccgtttgcgttcaccgccgcgctgcacacctacctgcgcgtc
ggcgaagtcgagaacgcccgtctcgaaggcctgcacggccacgaataccgcgacgccgcg
gacaacgaccgcatcaagcgcgacagcggcgatgcgctcgtcgtcgaagccgagaccgac
cgcgtctatcacgacgtgcagcgcccgttgctgctgcgcgacggcgggcgcagcctcggc
atcaacgtcgaaggttttccggacgtcgtggtgtggaacccgtgggaacagcgctgcgcg
caaatgcccgacctgccggccaacggattccggcacatgctgtgcgtcgaagccgcagcc
gcgcgccacaggatcgagctcgacgccggcgagcagtggtacgggcggcaaaccctgatc
gcgctgtaa

DBGET integrated database retrieval system