KEGG   Aromatoleum aromaticum: ebA6841Help
Entry
ebA6841           CDS       T00222                                 

Gene name
lysS
Definition
lysyl-tRNA synthetase
Orthology
K04567  
lysyl-tRNA synthetase, class II [EC:6.1.1.6]
Organism
eba  Aromatoleum aromaticum
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:eba00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    ebA6841 (lysS)
Enzymes [BR:eba01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.6  lysine---tRNA ligase
     ebA6841 (lysS)
Amino acid related enzymes [BR:eba01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   ebA6841 (lysS)
Transfer RNA biogenesis [BR:eba03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    ebA6841 (lysS)
 Prokaryotic Type
   Other AARSs
    ebA6841 (lysS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4059133..4060641
Genome map
AA seq 502 aa AA seqDB search
MSDQNNTPAASQDENHIISERREKLAAWRAGGRAFPNDFSRENIAGKLDEIYGEKESQEL
DATPVEVKVAGRIMLKRVMGKASFMTIQDLSGQIQLYVTRDAVGEDVYADFKHWDIGDIV
GAVGTLFKTRTGELSVKCTDIRLLTKSLRPLPDKFHGLTDVEQKYRQRHLDLIMNEQTRF
TFVARSRMVQSIRNYMVSHGFLEVETPMMHPIPGGAAAKPFTTHHNALDMELFLRIAPEL
YLKRLVVGGFEKVFEVNRNFRNEGLSPRHNPEFTMMEFYEAYANYKSLMNFTEGLLRQAA
REALGTEVFVYQGRELDLSKPFARLTIVEAIHQFHPGFSIAQLNDEAWLRAKLTDLKAKL
RDDAGLGTLQLMLFEETTEAELWEPTFIIDYPAEVSPLARRNDANPEITERFELFIVGRE
IANGFSELNDPEDQAARFLEQVKAKEAGDEEAMFYDADYIRALEYGLPPTGGCGIGIDRL
VMLLTDSPSIRDVILFPQMRTE
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaccagaacaacactcccgccgcctcgcaggacgagaatcacatcatttccgag
cggcgtgaaaagctggccgcgtggcgtgccggcggccgagctttcccgaacgatttctcg
cgcgagaacatcgccggcaaactcgatgagatctacggagaaaaggagtcgcaggagctc
gacgcgacgccggtcgaagtgaaagtggccgggcgcatcatgctcaaacgcgtgatgggc
aaggcgagcttcatgacgatccaggatctctccggacagatccagctgtacgtcacgcgc
gacgcggtcggcgaggacgtctacgccgacttcaagcactgggacatcggcgacatcgtc
ggcgccgtcggcacgctgttcaagacgcgcaccggcgagctgtcggtgaaatgcactgac
atccgcctgctgacgaaaagcctgcgcccgctccccgacaagttccacggcctgaccgac
gtcgagcagaaataccgccagcgccacctcgacctgatcatgaacgagcagacgcgcttc
acgttcgtcgcgcgcagccgcatggtgcagtcgatccgcaactacatggtcagccacggc
ttcctcgaagtcgagacgccgatgatgcacccgatcccggggggggccgcggcgaagccc
ttcacgacgcaccacaacgcgctcgacatggagctgttcctgcgcatcgcgccggagctg
tatctcaagcgcctcgtcgtcggcggcttcgagaaagtcttcgaggtgaaccgcaacttc
cgcaacgaaggcctctccccgcgccacaatcccgaattcacgatgatggagttctacgag
gcctacgcgaactacaagagcctgatgaacttcaccgaagggctgctgcgccaggccgct
cgcgaagcgctcggcaccgaagtgttcgtctaccagggtcgcgagctcgacctgtcgaag
ccgttcgcgcggctgacgatcgtcgaggcgatccaccagttccacccaggcttttcgatc
gcgcagttgaacgacgaagcctggctgcgcgcgaagctgaccgacctcaaggcgaagctg
cgcgacgacgcgggcctcggcacgctgcagctgatgctgttcgaggagaccaccgaagcc
gagctgtgggagccgacgttcatcatcgactaccccgccgaagtgtcgccgctcgcgcgc
cgcaacgacgcgaacccggagatcaccgaacgtttcgaactcttcatcgtcgggcgcgag
atcgccaacggcttctccgagctgaacgacccggaagaccaggccgcgcgcttcctcgag
caggtcaaggcgaaggaagccggcgacgaggaggcgatgttctacgacgccgactacatc
cgcgcgctcgaatatggcctgcccccgaccggcggctgcggcatcggcatcgaccgcctc
gtgatgctgctgaccgacagcccgagcatccgcgacgtgatcctgttcccgcagatgcgg
acggagtga

DBGET integrated database retrieval system