KEGG   Aromatoleum aromaticum EbN1: ebA6841Help
Entry
ebA6841           CDS       T00222                                 

Gene name
lysS
Definition
lysyl-tRNA synthetase
Orthology
K04567  
lysyl-tRNA synthetase, class II [EC:6.1.1.6]
Organism
eba  Aromatoleum aromaticum EbN1
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:eba00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4059133..4060641
Genome map
AA seq 502 aa AA seqDB search
MSDQNNTPAASQDENHIISERREKLAAWRAGGRAFPNDFSRENIAGKLDEIYGEKESQEL
DATPVEVKVAGRIMLKRVMGKASFMTIQDLSGQIQLYVTRDAVGEDVYADFKHWDIGDIV
GAVGTLFKTRTGELSVKCTDIRLLTKSLRPLPDKFHGLTDVEQKYRQRHLDLIMNEQTRF
TFVARSRMVQSIRNYMVSHGFLEVETPMMHPIPGGAAAKPFTTHHNALDMELFLRIAPEL
YLKRLVVGGFEKVFEVNRNFRNEGLSPRHNPEFTMMEFYEAYANYKSLMNFTEGLLRQAA
REALGTEVFVYQGRELDLSKPFARLTIVEAIHQFHPGFSIAQLNDEAWLRAKLTDLKAKL
RDDAGLGTLQLMLFEETTEAELWEPTFIIDYPAEVSPLARRNDANPEITERFELFIVGRE
IANGFSELNDPEDQAARFLEQVKAKEAGDEEAMFYDADYIRALEYGLPPTGGCGIGIDRL
VMLLTDSPSIRDVILFPQMRTE
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaccagaacaacactcccgccgcctcgcaggacgagaatcacatcatttccgag
cggcgtgaaaagctggccgcgtggcgtgccggcggccgagctttcccgaacgatttctcg
cgcgagaacatcgccggcaaactcgatgagatctacggagaaaaggagtcgcaggagctc
gacgcgacgccggtcgaagtgaaagtggccgggcgcatcatgctcaaacgcgtgatgggc
aaggcgagcttcatgacgatccaggatctctccggacagatccagctgtacgtcacgcgc
gacgcggtcggcgaggacgtctacgccgacttcaagcactgggacatcggcgacatcgtc
ggcgccgtcggcacgctgttcaagacgcgcaccggcgagctgtcggtgaaatgcactgac
atccgcctgctgacgaaaagcctgcgcccgctccccgacaagttccacggcctgaccgac
gtcgagcagaaataccgccagcgccacctcgacctgatcatgaacgagcagacgcgcttc
acgttcgtcgcgcgcagccgcatggtgcagtcgatccgcaactacatggtcagccacggc
ttcctcgaagtcgagacgccgatgatgcacccgatcccggggggggccgcggcgaagccc
ttcacgacgcaccacaacgcgctcgacatggagctgttcctgcgcatcgcgccggagctg
tatctcaagcgcctcgtcgtcggcggcttcgagaaagtcttcgaggtgaaccgcaacttc
cgcaacgaaggcctctccccgcgccacaatcccgaattcacgatgatggagttctacgag
gcctacgcgaactacaagagcctgatgaacttcaccgaagggctgctgcgccaggccgct
cgcgaagcgctcggcaccgaagtgttcgtctaccagggtcgcgagctcgacctgtcgaag
ccgttcgcgcggctgacgatcgtcgaggcgatccaccagttccacccaggcttttcgatc
gcgcagttgaacgacgaagcctggctgcgcgcgaagctgaccgacctcaaggcgaagctg
cgcgacgacgcgggcctcggcacgctgcagctgatgctgttcgaggagaccaccgaagcc
gagctgtgggagccgacgttcatcatcgactaccccgccgaagtgtcgccgctcgcgcgc
cgcaacgacgcgaacccggagatcaccgaacgtttcgaactcttcatcgtcgggcgcgag
atcgccaacggcttctccgagctgaacgacccggaagaccaggccgcgcgcttcctcgag
caggtcaaggcgaaggaagccggcgacgaggaggcgatgttctacgacgccgactacatc
cgcgcgctcgaatatggcctgcccccgaccggcggctgcggcatcggcatcgaccgcctc
gtgatgctgctgaccgacagcccgagcatccgcgacgtgatcctgttcccgcagatgcgg
acggagtga

DBGET integrated database retrieval system