KEGG   Aromatoleum aromaticum: ebA6918Help
Entry
ebA6918           CDS       T00222                                 

Gene name
treY
Definition
bifunctional 4-alpha-glucanotransferase/malto-oligosyltrehalose synthase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
K06044  
(1->4)-alpha-D-glucan 1-alpha-D-glucosylmutase [EC:5.4.99.15]
Organism
eba  Aromatoleum aromaticum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:eba00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ebA6918 (treY)
Enzymes [BR:eba01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     ebA6918 (treY)
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.15  (1->4)-alpha-D-glucan 1-alpha-D-glucosylmutase
     ebA6918 (treY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4096243..4101618)
Genome map
AA seq 1791 aa AA seqDB search
MDGETASERGIEKGEAGDSGRGHDGGGEARTGLDALCVYLGVALEYEDAWGRRTVVPEAK
KRDIVAALGYPVADQAEAEACLADLRAAARRRILPPLLVVQGGTPPLRLAANLPVEFIGR
TLPWRIVLEDGGERSGVVVPRPASADTPLPDSASPDSASPDAPLPEADGSGDDSRRPALL
ELPIDVPPGHHRLRLFEPAQPPRELATAALAICPATCFQLPRPAPQCLGDRLWGPAVQVY
ALRSSRNWGIGDFGDLLRLVDLAADAGAHVVGVNPLHALFPHDPVRASPYSPSSREWLNV
LYVEIETTRDYGECAAARGRVEEPVFQHRLDALRATEFVDYGGVAEAKFEVLEMLYRHFR
TVHLERNTQRAGLFRDFQREGGRSLRAHALFDALQERFFRIDPAVWGWTVWPEAYRDIDA
PAVEAFALANEERVEFFEYLQWQAEAQLRRVAARAQARGMAIGLYRDLAVGVNEGGSESW
ARPKLHALGIHAGAPPDELNPAGQDWGFPPVIPQRLAAECFEPFLAVLRANMRHAGALRI
DHVMSLMRLFWLPGDGQRQVGAYVAYPMEELLGLLCLESRSHRCVVIGEDLGIVPQEVRD
AMARHAILSYRPLYFEQDWDAGGFRAPRDWPAQAVAAVSTHDLPTLRSYWSGFDLQLRDR
LGMYREPGMRDRQFERREADRCALLAALAAEKGSGDEPNEVLGTDPARVADDDPHLAVAV
HRFIARTPAAIAVVQFEDVLGQLEGVNLPGTSESEYPNWRRKLGAALADIEVDPRWRAVS
AAVDAERPCPLRELSGGPPDFHPETAAIPRATYRLQFHADFGFAAAEAVLPYLAELGISH
VYAAPFLKARPGSRHGYDIIDHQAVNPEIGSEADFDRYCARLAELGLGQVLDVVPNHVGV
LGADNEWWLDVLENGEASECADHFDIDWHPPFPELRGKVLLPVLGDQYGLVLEAGELTLG
FSAERGEFSVHYFEHRFPVDPCDYPSILTPAASARGAQSVVDAEQVELETLLAALRHLPP
RDVADPALQTERRHNKNLFKQHLAALHERLPAVRARIGERLAAFNGRVGEPASFDALDAL
LARQAYRLASWRVAADDINYRRFFDINDLAALRMEVDSVFEATHAQIFRWLAQGRVSGLR
IDHPDGLAEPVAYFERLQARHAAICRELALAGGTPSAGPEPALYLVVEKILAEFEPLPAD
WPVHGDTGYRFANLCNGLFVDSAQESRFSRIYRAFTGEARNFSEVLHEAKLLIMTHSLPG
EVSGLAGLLHDIAQHDRRTRDFTRSRLRGALKEIVAGFPVYRTYIGPRGVSDTDRRYIER
AIATAAARTRAGDATVLRFVRDVLVSAPSETAAELRLLKLRFVRRFQQFTAPVMAKSMED
TAFYRYNRLVSLNDVGGDPHTFGIAVQDFHAANERVAASHPFGLVGSSTHDSKRSEDVRA
RIDVLSEMPGAWRLALRRWRKLNERHKRRVNDALAPSCNDEYLLYQTLLGVWPATPPESR
GLAELARRVDAYMLKAAREAKRHTSWMNPEPGYEAALSGFVRRLFAGGLDNPFVADFLPF
HARVSCFGCYNSLAMALLKLTAPGVPDIYQGCETWNYRLVDPDNRFPVDFAAARDLLHGL
KQECPDGADEARRRSALATMLDAMSEGRDDGRIKLYVLWRALAVRREFEQTMRFGRYVAL
ETDGPAALHVVAFARVLGDDIVVVVASRLLFTLCRGDAALLRDPTIWQDTFVELPAFSEG
RQWRDALCGQGVRPQCAGNRCHLDVARLFGALPLALLVPQRMRAAGAREAE
NT seq 5376 nt NT seq  +upstreamnt  +downstreamnt
atggacggcgaaacggcgagcgagagagggatcgagaagggggaggccggggactccggc
agggggcacgacgggggcggcgaggcgcgcacgggactcgacgcgctgtgcgtgtatctc
ggcgtcgcgctcgagtacgaggacgcctggggccggcgcacggtcgtgcccgaggcgaag
aagcgcgacatcgtcgccgcgctcggctatccggtcgccgaccaggcggaggcggaagcc
tgtctcgcggacctgcgcgccgccgcgcgccggcgcatcctgccgccactgctggtcgtg
cagggcggcacgccaccgctgcggctggcggcgaacctgccggtggagttcatcggccgc
acgctgccgtggcgcatcgtgctcgaggacggcggcgagcgttccggtgtcgtcgtgccg
cgccccgcctcggccgacacccccttgcccgattccgcttcgcccgattccgcctcgccc
gatgctcccctgccggaagccgacgggagtggcgacgacagtcgtcgcccggcgctgctg
gaactgcctatcgacgtgcctccgggccaccaccggctgcggctcttcgagcctgcgcag
ccgccgcgcgaactggccaccgcggcgctcgcgatctgccccgccacgtgtttccagctg
cctcgcccggcgccccagtgcctcggcgaccggttgtggggaccagccgtgcaggtgtat
gcgctgcgctcgtcgcgcaactgggggatcggcgatttcggcgacctgctgcgcctcgtc
gacctcgccgccgatgccggcgcgcacgttgtcggcgtcaatccgctgcatgcgctgttc
ccgcacgacccggtgcgcgcgagcccgtacagcccgtcgagccgcgaatggctcaacgtg
ctgtacgtcgagatcgagacgacgcgcgactacggcgaatgcgccgcggcgcgcgggcgc
gtcgaggagcctgtgttccagcatcgcctcgacgcgctgcgggcgactgaattcgtcgac
tacggcggcgtcgccgaggcgaagttcgaagtgctcgagatgctgtaccgccatttccgc
accgtgcatctcgagcgcaacacgcagcgtgccgggctgttccgcgacttccagcgcgag
ggcgggcgcagcctgcgcgcgcacgcgctgttcgacgcgctgcaggaacggttcttccgc
atcgatcccgcagtctggggctggacagtgtggcccgaggcgtaccgcgacatcgacgct
ccggcagtcgaagcgttcgccctcgccaacgaggagcgcgtcgagttcttcgagtacctg
cagtggcaggccgaagcgcagctgcgccgcgtcgccgcgcgggcgcaggcgcgcggcatg
gcgatcggcctgtaccgcgacctggcggtgggcgtgaacgaaggcggctcggaaagctgg
gcgcggccgaagctgcacgcgctcggcatccatgccggcgcgccgcccgacgaacttaac
ccggcagggcaggactggggttttcccccagtcatcccgcagcgcctcgcggccgagtgc
ttcgaacctttcctcgcggtgctgcgcgcgaacatgcgccacgccggcgcgctgcgcatc
gatcacgtgatgagcctgatgcgcctgttctggctgccgggcgacgggcagcgccaggtc
ggcgcctacgtcgcctacccgatggaggagctgctcgggctgctgtgcctcgagagccgc
agccatcgctgcgtcgtcatcggcgaggacctcggcatcgtgccgcaggaagtccgcgac
gcgatggcgcgccacgcgatcctttcgtaccgcccgctgtatttcgagcaggactgggac
gcgggcggcttccgggcgccgcgggactggccggcgcaggcagtcgcggcggtgtcgacg
cacgacctgccgacgctgcgcagctactggagcggcttcgacctgcagctgcgcgacagg
ctaggcatgtaccgcgagccggggatgcgcgatcgccagttcgaacgccgcgaagccgac
cgctgcgcgctgctcgctgcactggccgccgaaaagggctccggagatgagccaaatgag
gtgctcggcaccgatccggcgcgcgtcgcagacgacgatccgcacctcgcggtcgcggtg
catcgtttcatcgcacgtacgccggcggcaatcgccgtggtgcagttcgaggacgtcctg
ggacagctcgaaggcgtcaatttgccggggacgagcgagtccgaatacccgaactggcgc
cgcaagctcggcgccgctctcgccgacatcgaagtcgatccgcggtggcgcgcggtcagt
gccgcagtggacgcggaacggccgtgcccgctgcgcgagttgagcgggggcccgcccgac
ttccacccggaaactgcggcgatcccgcgtgcgacgtaccggctgcagttccacgccgac
ttcggcttcgctgcggccgaagcggtgctgccgtacctcgccgagctcggcatcagccac
gtctacgccgccccgttcctgaaggcgcgccccggcagccggcacggctacgacatcatc
gaccaccaggcggtgaatcccgagatcggcagcgaagccgacttcgaccgttattgtgcc
cgtctggccgagctcggactcgggcaggttctcgacgtcgtgccgaatcacgtcggcgtg
ctcggcgccgacaacgagtggtggctggacgtgctcgagaacggcgaggcgtccgaatgc
gcggatcacttcgacatcgactggcacccgcctttccccgagctgcgcggcaaagtgctg
ctgccggtgctcggcgaccagtacgggctggtgctcgaagccggtgagcttacgctcggt
ttcagcgccgagcgcggcgaattcagcgtgcattacttcgagcaccgcttccccgtcgat
ccgtgcgactacccgtctattctcactccggcagcgtcggcgcgcggcgcgcagagcgtc
gttgacgccgagcaggtcgaactcgagacgctgctcgcggcgctgcgccacctgccgccg
cgcgacgtcgccgacccggcgctgcagaccgagcgccgccacaacaagaacctcttcaag
cagcacctcgcggcgctccacgagcggctcccggcggtgcgggcgcgtatcggggaacgg
cttgcggcgttcaacgggcgcgtcggcgaaccggcgagcttcgatgcgctcgacgcgctg
ctcgcgcgccaggcataccggctcgcgtcgtggcgcgtcgccgccgacgatatcaactac
cgccgcttcttcgacatcaacgacttggcggcgctgcgcatggaagtggacagcgtgttc
gaggcgacgcacgcgcagatcttccgctggctcgcacaagggcgcgtgtcgggcctgcgt
atcgaccacccggacgggctcgccgagccggtcgcgtatttcgaacgcctgcaggcccgc
cacgcggccatctgccgcgagctggcgctcgccggcgggacgccgtccgcgggcccggag
cctgcgctgtacctcgtcgtcgagaaaatcctcgccgagttcgagccgctgccggccgac
tggccggtgcacggcgataccggctaccgcttcgcgaacctgtgcaacgggctgttcgtc
gattcagctcaggaatcgcgcttttcgcggatctaccgcgccttcaccggcgaagcgcgc
aatttcagcgaagtgctgcacgaagcgaagctgctgatcatgacgcattcgctgccgggc
gaagtcagcgggctggccgggctgctccacgatatcgcccagcacgaccggcgcacgcgc
gatttcacgcgcagccggctgcgcggcgcgctgaaggagatcgtcgccggcttcccggtc
tatcgcacctacatcgggccgcgcggagtctccgacaccgaccgccgctacatcgagcgc
gccatcgcgaccgctgccgcgcgcacgcgtgccggcgacgcgaccgtgctgcgcttcgtg
cgcgacgtgctggtttcggcgccgagcgaaaccgccgccgaactgcgcctgctcaagctg
cgcttcgtgcggcgcttccagcagttcaccgcgccggtgatggccaagtcgatggaagat
accgcgttctaccgctacaaccggctggtgtcgctcaacgacgtcggcggcgacccgcac
acgttcggcatcgcggtgcaggatttccacgccgccaacgagcgtgtcgcggcgagccac
ccgttcggcctggtcggcagctcgacccacgacagcaagcgctcggaggacgtgcgtgcg
cgcatcgacgtgctgtccgagatgccgggcgcgtggcggctcgcgctgcggcgctggcgc
aagctcaacgagcgccacaagcgtcgggtcaatgacgcgctcgcgccgtcgtgcaacgat
gagtacctgctgtaccagacgctgctcggcgtgtggccggcgacgccgcccgagagccgc
ggcctggccgagctcgcgcgtcgcgtcgatgcgtacatgctgaaagccgcgcgcgaggcg
aaacggcacaccagctggatgaaccccgagcccggctacgaggcggcgctttcgggcttc
gtgcggcgcctctttgccggcgggctcgacaacccgttcgtcgccgacttcctgccgttt
cacgcacgggtgtcgtgcttcggttgctacaacagcctcgcgatggcgctgctcaagctc
accgcccccggcgtgccggatatctaccagggctgcgagacctggaactaccggctcgtg
gaccccgataaccgcttcccggtcgatttcgctgccgcgcgcgacctcctgcacggcctg
aagcaggagtgcccggacggcgcggacgaggccaggcggcgcagcgcgctcgccacgatg
ctcgacgcgatgtccgagggtcgcgacgacggccgcatcaagctttatgtgctgtggcga
gcgctcgcggtgcggcgcgagttcgagcagacgatgcgtttcggccgctacgttgcgctg
gagacggacgggccggcggcgctgcacgtcgtcgcgttcgcgcgcgtgctcggtgacgac
atcgtcgtcgtcgtcgcctcgcgcctgctgtttacgctgtgccgcggcgatgccgcgctg
ctgcgcgacccgacgatctggcaggacacgttcgtcgagctgccggcgttctcggaaggc
cggcaatggcgcgacgcgctgtgcgggcagggtgtgcggccgcagtgcgccggcaaccgc
tgccatctcgatgtcgcgcgcctcttcggtgcgctgccgctggccctgctcgtgccccaa
cgcatgcgtgccgccggcgcccgggaggcggaatga

DBGET integrated database retrieval system