KEGG   Aromatoleum aromaticum: ebA7003Help
Entry
ebA7003           CDS       T00222                                 

Gene name
glgB
Definition
(GenBank) 1,4-alpha-glucan branching enzyme (EC:2.4.1.18)
  KO
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
eba  Aromatoleum aromaticum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:eba00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ebA7003 (glgB)
Enzymes [BR:eba01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     ebA7003 (glgB)
Exosome [BR:eba04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ebA7003 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(4145485..4147395)
Genome map
AA seq 636 aa AA seqDB search
MDATTTHSRLSEHDIYLFREGSHGRLYDKLGCQLDEAGAHFAVWAPNARAVAVIGSFNAW
RDDAAVLRPRDDGSGIWEGFVAGVAAGDVYKYSIVCQDGRVAEKADPFAQYAEVPPATGS
RAWRSAHRWADDAWMAGRARANALDAPFSIYELHLGSWRRAQDGALPGYREIAPQLAAYV
VEWGFTHVELMPLSEHPFYGSWGYQTTGYFAATARYGTPDDLMFLIDTLHQAGVGVILDW
VPSHFPSDAHGLAEFDGTYLYEHADPRQGFHPEWHSCIFNYGRHEVCAFLLSSALFWLER
FHIDGLRVDAVASMLYLDYGRQHGEWVPNRYGGRENLDAVAFLRRLNEAVYRDHPGVQTI
AEESTAWPMVSRPLYVGGLGFGMKWNMGWMHDSLDYFRHDPLFRKFHHGRITFSIWYAFH
ENFVLPLSHDEVVYGKGSLIGKMPGDSWQQFAGLRALFGYMWAHPGKKLLFMGGEFGQRR
EWTHEGELEWWVLDRPEHAGLRHWVGDLNRLYRERAALHELDFDEAGFQWIDSDDSENSV
LSFLRKSRNGATVLVICNFTPVTRPNYTLGVPRAGFWREALNSDATLYGGSGAGNLGGVE
TVPVPAHGHYQSLTLTLPPLAVLFLIPEVDDARPDS
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atggacgccacgacgacgcacagccgcctctccgaacacgacatctacctgttccgggag
ggttcgcacggccggctctacgacaagctcggctgccagttagacgaggccggcgcgcat
ttcgccgtgtgggcgccgaacgcgcgggcggtagcggtgatcgggagcttcaatgcgtgg
cgcgacgatgccgcagtgctgcgtccgcgtgacgacgggtcgggcatctgggaaggtttc
gtcgccggcgtcgcggcgggtgacgtctataagtacagcatcgtgtgccaggacgggcgc
gtcgccgagaaggccgacccgttcgcgcagtatgcggaggtaccgccggcgaccggttcg
cgcgcgtggcgcagcgctcaccgctgggccgacgacgcgtggatggccgggcgcgcccgt
gcgaacgcgctcgatgcgccgttcagcatctacgaactgcacctcggctcgtggcgtcgc
gcgcaggacggtgcgctgccgggctaccgcgagatcgcgccgcagctcgccgcgtacgtc
gtcgagtggggctttacgcatgtcgaactgatgccgctctcggagcacccgttctacggt
tcgtggggttaccagacgaccggctattttgccgcgacggcgcgctacggcacgccggac
gacctgatgttcctgatcgacacgctgcaccaggcgggcgtcggcgtgatcctcgactgg
gtgccgtcgcattttccgagcgatgcgcacggcctggccgagttcgacggcacctacctg
tacgaacatgcggacccgcgccaggggttccacccggaatggcattcgtgcatcttcaat
tacgggcgccacgaagtgtgtgcgttcctgctgtcgtccgcgctgttctggcttgaacgc
ttccatatcgacgggctgcgtgtcgatgcggtcgcgtcgatgttgtatctcgattacggc
cgccagcacggcgagtgggtgccgaaccgctacggcggccgggagaacctcgacgcggtc
gcgttcctgcggcggctcaacgaggcggtgtatcgtgaccacccgggggtgcagacgatc
gcggaagagtcgactgcgtggccgatggtgtcgcgcccgctgtatgtcggcggcctgggc
ttcggcatgaaatggaacatgggctggatgcacgactcgctcgactatttccgccacgac
ccgctgttccgcaagttccaccacggccggatcacgttctcgatctggtacgcgttccac
gagaacttcgtgctgccgctgtcccacgacgaagtcgtctacggcaagggctcgctgatc
ggcaagatgcccggcgacagctggcagcagttcgccgggctgcgcgcgctgttcggctac
atgtgggcgcatcccggcaaaaagctgctgttcatgggcggcgagttcggccagcggcgc
gaatggacgcacgagggcgaactcgaatggtgggtgctcgaccggccggaacacgccgga
ttgcggcactgggtcggcgacctgaaccgcttgtatcgcgagcgcgccgcgctgcacgag
ctcgatttcgacgaagccggtttccagtggatcgacagcgacgacagcgaaaacagcgtg
ctgtcgttcctgcgcaagtcgcgcaacggcgccactgtcctcgtcatctgcaatttcacg
ccggtgacgcggccgaactacacgcttggcgtgccgcgcgccgggttctggcgcgaggcc
ctcaacagcgacgcgacgctgtacggcggcagcggggcgggcaacctgggcggcgtcgaa
accgtgccggtgcctgcgcacggccattaccagtcgctgacgctgacgctgccgccgctg
gcggtgctgttcctgattccggaggtcgacgatgcgcgcccggacagctga

DBGET integrated database retrieval system