KEGG   Aromatoleum aromaticum EbN1: ebA7113Help
Entry
ebA7113           CDS       T00222                                 

Gene name
folK
Definition
7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
eba  Aromatoleum aromaticum EbN1
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:eba00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4200343..4200867
Genome map
AA seq 174 aa AA seqDB search
MKRSGPGRTGATHAPVRAFVALGSNLGQPVATLRTAFEALDRLPDTRVVARSALYRTAPV
GVRGQPDFFNAVAALDTALPARALLDALFAIEAQFGRTRAYPQAPRTLDLDLLLYDDGTV
TEPGLEIPHPRMHLRAFVLVPLAEIAPAATIPGRGRVADLLPGVRDQTIERLPD
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgatccggccccggccggaccggcgccacgcacgctcctgtgcgcgctttcgtc
gcgctgggctcgaacctcggccagccggtcgcgacgctccggactgcattcgaggccctc
gacaggttgcccgacacccgcgtcgtcgcccgttcggcgctgtaccgcaccgccccggtg
ggtgtgcgcgggcagccggacttcttcaacgcggtcgctgcgctcgacacggcactgccc
gcgcgggcgctgctcgacgccttgttcgccatcgaggcgcaattcggccgcacccgggca
tatccgcaggcgccacggacgctggacctcgacctgctgctctacgacgacggcaccgtc
actgaacccggactcgaaatcccgcatccgcgcatgcacctgcgcgctttcgtgctcgtc
cccctcgcggaaatcgctccggcggcgacgatcccgggccgcgggcgcgtcgccgacctc
ctgccaggagtacgcgaccaaacaattgaaaggctgccggactga

DBGET integrated database retrieval system