KEGG   Aromatoleum aromaticum: ebA7175Help
Entry
ebA7175           CDS       T00222                                 

Gene name
holC
Definition
(GenBank) DNA polymerase III, chi subunit
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
eba  Aromatoleum aromaticum
Pathway
eba00230  Purine metabolism
eba00240  Pyrimidine metabolism
eba01100  Metabolic pathways
eba03030  DNA replication
eba03430  Mismatch repair
eba03440  Homologous recombination
Module
eba_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:eba00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    ebA7175 (holC)
   00240 Pyrimidine metabolism
    ebA7175 (holC)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    ebA7175 (holC)
   03430 Mismatch repair
    ebA7175 (holC)
   03440 Homologous recombination
    ebA7175 (holC)
Enzymes [BR:eba01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     ebA7175 (holC)
DNA replication proteins [BR:eba03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     ebA7175 (holC)
DNA repair and recombination proteins [BR:eba03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     ebA7175 (holC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_chi
Motif
Other DBs
NCBI-ProteinID: CAI10194
UniProt: Q5NXM0
Position
4232338..4232775
Genome map
AA seq 145 aa AA seqDB search
MARVQFYHNAENPLALACELAARAYASGRRVAVRVPGPAAARELDQLLWSFEPLLFVPHV
MADAPLAARTPVVIGDAARTTRWPHAELLFNLADDIPPDFERFRMLVEIVGQSEAMKIPA
RARWAHYKQRELPLQAFDAVRREAL
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgggtgcagttttaccacaacgccgagaaccctctcgcgctggcgtgcgaactg
gctgcccgcgcctacgcgagcgggcggcgggtcgcggtgcgggtgccaggcccggccgcg
gcgcgcgagctcgaccagctgctgtggagctttgagccgctgctgttcgtcccccacgtg
atggcggacgcgcccctggcagcccggactccggtcgtcatcggcgacgctgcacggacg
accaggtggccgcatgccgagctgctgttcaatctcgccgacgatatcccgcccgatttc
gagcgctttcgcatgctcgtcgagatcgtcggccagagcgaagccatgaagatcccggcg
cgggcacgctgggcacactacaagcagcgcgaactaccgctgcaggcgttcgatgcggta
cggcgggaggcgttatga

DBGET integrated database retrieval system