KEGG   Aromatoleum aromaticum EbN1: ebA7175Help
Entry
ebA7175           CDS       T00222                                 

Gene name
holC
Definition
DNA polymerase III subunit chi (EC:2.7.7.7)
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
eba  Aromatoleum aromaticum EbN1
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:eba00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:eba00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:eba03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:eba03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:eba03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4232338..4232775
Genome map
AA seq 145 aa AA seqDB search
MARVQFYHNAENPLALACELAARAYASGRRVAVRVPGPAAARELDQLLWSFEPLLFVPHV
MADAPLAARTPVVIGDAARTTRWPHAELLFNLADDIPPDFERFRMLVEIVGQSEAMKIPA
RARWAHYKQRELPLQAFDAVRREAL
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgggtgcagttttaccacaacgccgagaaccctctcgcgctggcgtgcgaactg
gctgcccgcgcctacgcgagcgggcggcgggtcgcggtgcgggtgccaggcccggccgcg
gcgcgcgagctcgaccagctgctgtggagctttgagccgctgctgttcgtcccccacgtg
atggcggacgcgcccctggcagcccggactccggtcgtcatcggcgacgctgcacggacg
accaggtggccgcatgccgagctgctgttcaatctcgccgacgatatcccgcccgatttc
gagcgctttcgcatgctcgtcgagatcgtcggccagagcgaagccatgaagatcccggcg
cgggcacgctgggcacactacaagcagcgcgaactaccgctgcaggcgttcgatgcggta
cggcgggaggcgttatga

DBGET integrated database retrieval system