KEGG   Aromatoleum aromaticum: ebA819Help
Entry
ebA819            CDS       T00222                                 

Gene name
glcB
Definition
(RefSeq) malate synthase G (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
eba  Aromatoleum aromaticum
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:eba00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ebA819 (glcB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ebA819 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    ebA819 (glcB)
Enzymes [BR:eba01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     ebA819 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
472271..474448
Genome map
AA seq 725 aa AA seqDB search
MTERIQCNQLQVDAALHRFIENEALPGTGLEAAAFWKGFSELANELAPKNRALLAERDRL
QAEIDTWHRAHPGPIQDMPAYRAFLESIGYLQPVPAPFKITTANVDSEISEQAGPQLVVP
IMNARYALNAANARWGSLYDALYGTNAIPSDGGAEAGSSYNPVRGARVIAFARNLLDQAA
PLAQGSHDKTKAYAVAGGKLIVTLLDGSQTGLADPAKFAGFQGDAAAPSAVLLKNNGLHL
EIQFDRKHPIGKTDAAGIKDVLVEAAVTTIMDCEDSTAAVDAEDKVVVYRSWLGLITGTL
VETFDKGGKTVERKMNPDREYTAPNGSALRLHGRSLLFIRHVGHLMTNPAILLADGAEIP
EGIMDGVVTTLISMRDLKLKRNSRTDSMYIVKPKMHGPAEVAFASELFGRVEQLLGLPAD
TMKVGIMDEERRTSVNLAGCIKAAESRVAFINTGFLDRTGDEMHTAMEAGPMIRKGDMKG
SAWIQAYERQNVLVGLDCGLRGRAQIGKGMWAMPDLMAEMLEQKIGHPKAGATTAWVPSP
TGATLHALHYHQVDVQSVQQEMEKISLAAERDTLLDNLLTVPVAASANWSATEIQQELDN
NAQGILGYVVRWIDQGVGCSKVPDINNIGLMEDRATLRISSQHIANWLRHGVTNEAQVLE
TMKRMAAVVDQQNAGDPLYRPMAPDFDQSVAFQAAKDLVFKGCAQPSGYTEPLLHRWRQV
AKARG
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaacgaatccaatgtaatcagctccaggtggacgcggcgctgcaccgcttcatc
gaaaacgaagccctgcccggcacgggcctcgaggcggcggcgttctggaaaggcttcagc
gaactggcgaacgaactggcgccgaagaaccgcgcgctgctcgccgagcgcgaccgcctg
caggccgagatcgatacctggcaccgcgcgcatccgggtccgatccaggacatgcccgcg
taccgcgctttcctcgagtcgatcggctacctgcagccggtgccggcgccgttcaagatc
acgaccgccaacgtcgacagcgaaatcagcgagcaggccggcccgcagctggtcgtgccg
atcatgaacgcccgttacgcactcaacgccgcgaacgcgcgctggggcagcctctacgac
gcgctgtacggcacgaacgcgatcccttcggacggcggcgccgaagccggctcgtcgtac
aacccggtgcgcggcgctcgcgtcatcgccttcgcccgcaatctgctggaccaggctgcg
ccgctcgcgcaaggcagccatgacaagaccaaggcctatgcggtcgctggcggcaagctg
atcgttacgctgctggacggcagccagaccggcctcgccgatcccgccaagttcgccggc
ttccagggcgacgctgcggcaccgtctgccgtgctgctcaagaacaacggcctgcacctc
gagatccagttcgaccgcaagcatccgatcggcaagaccgacgccgccggcatcaaggac
gtgctcgtcgaagctgccgtcacgacgatcatggactgcgaggattcgaccgccgcggtc
gatgccgaagacaaggtcgtcgtctaccgcagctggctggggctgatcaccggcaccctc
gtcgagaccttcgacaagggtggcaagacggtcgagcgcaagatgaacccggaccgcgaa
tacactgccccgaacggctccgcgctgcgcctgcatggccgctcgctgctcttcatccgc
cacgtcggccacctgatgaccaatccggccatcctgcttgccgacggagccgagatcccc
gaaggcatcatggacggcgtcgtcacgacgctgatttcgatgcgcgacctgaagctgaag
cgcaactcgcgcaccgacagcatgtacatcgtcaagccgaagatgcacggcccggccgaa
gtcgccttcgcaagcgaactcttcggccgcgtcgagcagctgctgggcctgcccgccgac
acgatgaaggtcggcatcatggacgaggagcgtcgcacctcggtgaacctcgccggctgc
atcaaggccgccgaatcgcgggtcgccttcatcaacaccggcttcctcgaccgcaccggc
gacgagatgcacaccgcgatggaagcgggcccgatgatccgcaagggcgacatgaagggc
tcggcgtggatccaggcctacgagcgccagaacgtgctggtgggcctcgactgcggcctg
cgcggtcgcgcgcagatcggcaagggcatgtgggcgatgccggacctgatggccgagatg
ctcgagcagaagatcggtcacccgaaggccggcgcaacgaccgcatgggtgccgtcaccg
accggcgcgaccctgcacgcgctgcactaccatcaggtggatgtccagtccgtgcagcag
gagatggagaaaatcagcctcgccgccgagcgcgacactctcctcgacaatctcctgacc
gtgccggtcgcggcctccgcgaactggagcgccaccgagatccagcaggaactcgacaac
aacgcgcaaggcatcctcggttacgtcgtgcgctggatcgaccagggcgtgggctgctcg
aaggtgccggacatcaacaatatcggcctgatggaagaccgcgcgacgctgcgcatctcg
agccagcacatcgcgaattggctgcgccacggcgtaacgaacgaagcccaggtcctcgag
acgatgaagcgcatggcggcggtcgtcgaccagcagaacgcgggcgatccgctgtaccgc
ccgatggcgccggatttcgaccagtcggtcgcgttccaggcggcaaaggacctcgtgttc
aagggctgcgcccagccgagcggttacaccgaaccgctgctgcaccgctggcgccaggtc
gcgaaagcgcgcggctga

DBGET integrated database retrieval system