KEGG   Aromatoleum aromaticum EbN1: ebA819Help
Entry
ebA819            CDS       T00222                                 

Gene name
glcB
Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
eba  Aromatoleum aromaticum EbN1
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:eba01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:eba00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:eba00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
472271..474448
Genome map
AA seq 725 aa AA seqDB search
MTERIQCNQLQVDAALHRFIENEALPGTGLEAAAFWKGFSELANELAPKNRALLAERDRL
QAEIDTWHRAHPGPIQDMPAYRAFLESIGYLQPVPAPFKITTANVDSEISEQAGPQLVVP
IMNARYALNAANARWGSLYDALYGTNAIPSDGGAEAGSSYNPVRGARVIAFARNLLDQAA
PLAQGSHDKTKAYAVAGGKLIVTLLDGSQTGLADPAKFAGFQGDAAAPSAVLLKNNGLHL
EIQFDRKHPIGKTDAAGIKDVLVEAAVTTIMDCEDSTAAVDAEDKVVVYRSWLGLITGTL
VETFDKGGKTVERKMNPDREYTAPNGSALRLHGRSLLFIRHVGHLMTNPAILLADGAEIP
EGIMDGVVTTLISMRDLKLKRNSRTDSMYIVKPKMHGPAEVAFASELFGRVEQLLGLPAD
TMKVGIMDEERRTSVNLAGCIKAAESRVAFINTGFLDRTGDEMHTAMEAGPMIRKGDMKG
SAWIQAYERQNVLVGLDCGLRGRAQIGKGMWAMPDLMAEMLEQKIGHPKAGATTAWVPSP
TGATLHALHYHQVDVQSVQQEMEKISLAAERDTLLDNLLTVPVAASANWSATEIQQELDN
NAQGILGYVVRWIDQGVGCSKVPDINNIGLMEDRATLRISSQHIANWLRHGVTNEAQVLE
TMKRMAAVVDQQNAGDPLYRPMAPDFDQSVAFQAAKDLVFKGCAQPSGYTEPLLHRWRQV
AKARG
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaacgaatccaatgtaatcagctccaggtggacgcggcgctgcaccgcttcatc
gaaaacgaagccctgcccggcacgggcctcgaggcggcggcgttctggaaaggcttcagc
gaactggcgaacgaactggcgccgaagaaccgcgcgctgctcgccgagcgcgaccgcctg
caggccgagatcgatacctggcaccgcgcgcatccgggtccgatccaggacatgcccgcg
taccgcgctttcctcgagtcgatcggctacctgcagccggtgccggcgccgttcaagatc
acgaccgccaacgtcgacagcgaaatcagcgagcaggccggcccgcagctggtcgtgccg
atcatgaacgcccgttacgcactcaacgccgcgaacgcgcgctggggcagcctctacgac
gcgctgtacggcacgaacgcgatcccttcggacggcggcgccgaagccggctcgtcgtac
aacccggtgcgcggcgctcgcgtcatcgccttcgcccgcaatctgctggaccaggctgcg
ccgctcgcgcaaggcagccatgacaagaccaaggcctatgcggtcgctggcggcaagctg
atcgttacgctgctggacggcagccagaccggcctcgccgatcccgccaagttcgccggc
ttccagggcgacgctgcggcaccgtctgccgtgctgctcaagaacaacggcctgcacctc
gagatccagttcgaccgcaagcatccgatcggcaagaccgacgccgccggcatcaaggac
gtgctcgtcgaagctgccgtcacgacgatcatggactgcgaggattcgaccgccgcggtc
gatgccgaagacaaggtcgtcgtctaccgcagctggctggggctgatcaccggcaccctc
gtcgagaccttcgacaagggtggcaagacggtcgagcgcaagatgaacccggaccgcgaa
tacactgccccgaacggctccgcgctgcgcctgcatggccgctcgctgctcttcatccgc
cacgtcggccacctgatgaccaatccggccatcctgcttgccgacggagccgagatcccc
gaaggcatcatggacggcgtcgtcacgacgctgatttcgatgcgcgacctgaagctgaag
cgcaactcgcgcaccgacagcatgtacatcgtcaagccgaagatgcacggcccggccgaa
gtcgccttcgcaagcgaactcttcggccgcgtcgagcagctgctgggcctgcccgccgac
acgatgaaggtcggcatcatggacgaggagcgtcgcacctcggtgaacctcgccggctgc
atcaaggccgccgaatcgcgggtcgccttcatcaacaccggcttcctcgaccgcaccggc
gacgagatgcacaccgcgatggaagcgggcccgatgatccgcaagggcgacatgaagggc
tcggcgtggatccaggcctacgagcgccagaacgtgctggtgggcctcgactgcggcctg
cgcggtcgcgcgcagatcggcaagggcatgtgggcgatgccggacctgatggccgagatg
ctcgagcagaagatcggtcacccgaaggccggcgcaacgaccgcatgggtgccgtcaccg
accggcgcgaccctgcacgcgctgcactaccatcaggtggatgtccagtccgtgcagcag
gagatggagaaaatcagcctcgccgccgagcgcgacactctcctcgacaatctcctgacc
gtgccggtcgcggcctccgcgaactggagcgccaccgagatccagcaggaactcgacaac
aacgcgcaaggcatcctcggttacgtcgtgcgctggatcgaccagggcgtgggctgctcg
aaggtgccggacatcaacaatatcggcctgatggaagaccgcgcgacgctgcgcatctcg
agccagcacatcgcgaattggctgcgccacggcgtaacgaacgaagcccaggtcctcgag
acgatgaagcgcatggcggcggtcgtcgaccagcagaacgcgggcgatccgctgtaccgc
ccgatggcgccggatttcgaccagtcggtcgcgttccaggcggcaaaggacctcgtgttc
aagggctgcgcccagccgagcggttacaccgaaccgctgctgcaccgctggcgccaggtc
gcgaaagcgcgcggctga

DBGET integrated database retrieval system