KEGG   Aromatoleum aromaticum: ebA844Help
Entry
ebA844            CDS       T00222                                 

Gene name
proB
Definition
(GenBank) Glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
eba  Aromatoleum aromaticum
Pathway
eba00330  Arginine and proline metabolism
eba00332  Carbapenem biosynthesis
eba01100  Metabolic pathways
eba01130  Biosynthesis of antibiotics
eba01230  Biosynthesis of amino acids
Module
eba_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:eba00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    ebA844 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    ebA844 (proB)
Enzymes [BR:eba01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     ebA844 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA SAM_2
Motif
Other DBs
NCBI-ProteinID: CAI06568
UniProt: Q5P7Z3
Position
494165..495280
Genome map
AA seq 371 aa AA seqDB search
MRDKIRNARRIVVKVGSALVTNNGAGLDKAAMGDWARQIATLRGAGKQVVLVSSGAIAAG
MQRLGWQKRPHEMHKLQAAAAVGQMGLVKAYEDAFSRHNLHTAQILLTHDDLADRKRYLN
ARSTLTTLLELGVVPIINENDTIVTDEIKFGDNDTLGALVANLIEAHALVILTDQQGLYT
ADPRRDPNATLVCEGRAEDRSYEAMAGGAGTGISRGGMITKIRAAQRAARSGAHTCIASG
NEVDALIRLTQAEPLGTLLYATSSPLQARKQWLADHLQLAGDLILDDGAVVALRSGRSLL
PVGVVEVGGEFERGAAVACRSAGGDEIARGLVNYSSSECRRIARKSSTQIEKLLGYIDEP
ELVHRDNMVLR
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgagagacaagatccgcaacgcgcgacgcatcgtcgtcaaagtcggcagcgcactcgtc
acgaacaacggcgccggactcgacaaagcggcgatgggcgactgggcgcgccagatcgca
acgttgcgtggcgcgggcaagcaggtcgtgctggtgtcgtccggtgcgatcgccgcggga
atgcagcgcctcggctggcaaaagcgcccgcacgaaatgcacaagctgcaggccgccgcc
gcggtcgggcaaatgggcctcgtcaaagcctacgaggatgccttttcgcgtcacaatctc
cacaccgcgcagatcctgctgacccacgacgacctcgccgaccgcaagcgctacctcaac
gcacgttcgacgctgacgacgctgctcgagctgggcgtcgtgccgatcatcaacgagaac
gacacgatcgtcaccgacgagatcaagttcggcgacaacgacacgctcggcgcgctggtc
gcgaacctcatcgaagctcatgcgctggtgatcctcaccgaccagcaaggcttgtacact
gccgacccgcgccgcgaccccaatgcgacgctcgtctgcgaaggtcgggccgaggacagg
tcgtacgaagcgatggcaggcggcgccggcaccggtatcagcaggggcggcatgatcacg
aagatccgcgccgcccagcgtgcggcgcgaagcggggcgcacacgtgcatcgcgagcggc
aacgaagtcgacgcgctgatccgcctcacgcaggccgaaccgctcggcaccctgctctac
gcgaccagttcgccgctgcaggcgcgcaagcagtggctcgccgaccacctgcagctcgcg
ggcgacctcattctcgacgacggcgcggtcgttgcgttgcgcagcggacgcagcttgttg
cccgtgggcgtcgtcgaggtcggaggcgaattcgagcgcggcgcagcggtcgcatgccgt
agcgccggcggtgacgagatcgcacgcggcctagtcaactacagtagcagcgagtgccgc
cgcatcgcgcgcaaatccagcacacaaatcgaaaagctgctcggctacatcgacgaaccc
gaactggttcaccgcgacaacatggtactgcgataa

DBGET integrated database retrieval system