KEGG   Aromatoleum aromaticum: ebA996Help
Entry
ebA996            CDS       T00222                                 

Definition
phosphoglucomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
eba  Aromatoleum aromaticum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:eba00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ebA996
   00030 Pentose phosphate pathway
    ebA996
   00051 Fructose and mannose metabolism
    ebA996
   00052 Galactose metabolism
    ebA996
   00500 Starch and sucrose metabolism
    ebA996
   00520 Amino sugar and nucleotide sugar metabolism
    ebA996
  Nucleotide metabolism
   00230 Purine metabolism
    ebA996
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    ebA996
Enzymes [BR:eba01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     ebA996
    5.4.2.8  phosphomannomutase
     ebA996
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
584460..585914
Genome map
AA seq 484 aa AA seqDB search
MPPVIHPHLRPACAMTPTPNSATPSSYAPPAAEIFKAYDIRGIVDKTLTAEAVGAIGHAL
GSEARKRSQRAIAIGRDGRLSGPELAGALADGIRAAGVDVIDIGCVPTPLTYFAAYHLGT
DSCVSVTGSHNPPDYNGLKMVLGGETLHGELIQDLRRRIVANDLTHGAGELREAPVIDAY
LDRVTADVKLARPMKIVIDCGNGVAGAVAPQLFRRLGCELVELFCDVDGTFPNHHPDPSK
PENLQDVIRALRDTDAELGLAFDGDGDRLGIVTKAGQIIYPDRQLMLFAADVLSRVPGGE
IIYDVKCTRNLAGWIRKHGGKPTMWNTGHALVKAKLRETGAPLAGEMSGHVFFKERWFGF
DDGLYAGARLLEILSRAADPSAVLDALPDAVSTPELNIKMAEGEPFELVRRLKESARFGG
ATEVITIDGVRVEYTDGFGLARPSNTTPVVVLRFEADSQQAIERIQADFRRAIEGVWPGV
QLPF
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgccgcccgtcattcacccccaccttcgaccggcctgcgccatgactcctactccgaac
tccgcgacgccctcctcctacgctccgcccgctgccgagatcttcaaggcctacgacatc
cgcggcatcgtcgacaagacgctcaccgccgaggccgtcggcgcgatcgggcatgcactg
ggttccgaggcgcgcaaacgctcgcagcgcgcgatcgcgatcggccgtgacgggcgcctg
tcgggccccgagctggcgggcgcgctcgccgacggcatccgcgctgccggcgtcgatgtc
atcgacatcggctgcgtgccgacgccgctgacgtacttcgccgcctatcatctcggcacc
gattcctgcgtcagcgtcaccggcagccacaatccgcccgactacaacggcctgaagatg
gtgctcggcggcgagaccctccacggcgaactgatccaggacctgcgccggcgcatcgtc
gccaacgacctcacccacggcgcaggcgaactgcgcgaagccccggtcatcgacgcctat
ctcgaccgcgtcaccgccgacgtgaaactcgcccggccgatgaagatcgtcatcgactgc
ggcaacggcgtcgccggcgcagtcgccccgcagctcttccgccgcctcggctgcgaactc
gtcgagctcttctgcgacgtcgacggcacgttcccgaaccaccatcccgatccgtccaag
cccgagaacctgcaggacgtcatccgcgcgctgcgcgacacggacgccgaactgggcctc
gcgttcgacggcgacggcgaccgcctcggcatcgtcacgaaagccggccagatcatctac
cccgaccgccagctgatgctgtttgccgccgacgtgctgtcgcgcgtgccgggcggcgag
atcatctacgacgtcaaatgcacgcgcaacctcgccggctggatccgcaagcacggcggc
aagccgacgatgtggaacaccggccacgcgctcgtgaaggcgaagctcagggaaaccggc
gcgccgctcgccggcgagatgagcggccacgtgttcttcaaggagcgctggttcggcttc
gacgacggcctgtacgccggcgcacgcctgctcgagatcctgtcgcgcgcagccgatccc
agcgcggtgctcgacgcgctgcccgatgcggtgagcacgcccgagctcaatatcaagatg
gccgaaggcgagccgttcgagctcgtgcgccggctgaaggagtccgcgcgcttcggcggc
gccaccgaggtgatcacgatcgacggcgtgcgtgtcgaatacaccgacggcttcggcctc
gcgcggccgtcgaacacgacaccggtcgtcgtgctgcgcttcgaagccgactcgcagcaa
gcgatcgagcgcatccaggcggatttcaggcgcgcgatcgaaggcgtctggccgggcgtg
cagctgccgttctga

DBGET integrated database retrieval system