KEGG   Aromatoleum aromaticum: ebB214Help
Entry
ebB214            CDS       T00222                                 

Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
eba  Aromatoleum aromaticum
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:eba00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    ebB214
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    ebB214
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3594097..3594465)
Genome map
AA seq 122 aa AA seqDB search
MLVVLASASSSGAAGTALRGEEIYARCLACHALAYNRTGPRHCGLFGRRAGSLPDYGYSD
AMRESGIVWDAATLDRFLAAPTRVVPGTTMGYAGIPDPAERAALIEWLRETSRPGTACPE
NP
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
gtgctggttgtgctggcatccgcctcatcgtccggggcggcaggcacggcgctgcgcggc
gaggaaatctatgcacgctgcctcgcctgccacgcgctcgcctacaaccgcaccggcccg
cgccattgcggactgttcggccggcgagcgggcagccttcccgactacggatattcggat
gcgatgcgggagtccggcatcgtctgggacgcggcaacgctcgaccgatttctcgcggcg
ccgacccgggtcgtacccggcacgacgatgggctacgcaggcatccccgatccggccgag
cgcgccgcgctcatcgaatggctgcgcgagacctcgcgccccggcacggcctgcccggaa
aatccgtga

DBGET integrated database retrieval system