KEGG   Aromatoleum aromaticum: p2A409Help
Entry
p2A409            CDS       T00222                                 

Gene name
tioL
Definition
(GenBank) beta-ketothiolase protein
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
eba  Aromatoleum aromaticum
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:eba00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    p2A409 (tioL)
   00630 Glyoxylate and dicarboxylate metabolism
    p2A409 (tioL)
   00640 Propanoate metabolism
    p2A409 (tioL)
   00650 Butanoate metabolism
    p2A409 (tioL)
  Lipid metabolism
   00071 Fatty acid degradation
    p2A409 (tioL)
   00072 Synthesis and degradation of ketone bodies
    p2A409 (tioL)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    p2A409 (tioL)
   00310 Lysine degradation
    p2A409 (tioL)
   00380 Tryptophan metabolism
    p2A409 (tioL)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    p2A409 (tioL)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    p2A409 (tioL)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    p2A409 (tioL)
Enzymes [BR:eba01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     p2A409 (tioL)
Exosome [BR:eba04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   p2A409 (tioL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
p2:221924..223111
Genome map
AA seq 395 aa AA seqDB search
MTQREVVVVGAARTAIGTFGGSLRDVPLTRLGTVAVEAALKRSGVNPQEVGHVVMGNVIP
TEPRDAYLSRVAAMDAGVPKETPAFNVNRLCGSALQAVVSAAQSILLSDTDIAIGGGAET
MSRGAYLLPASRWGARMGDSQVVDYMNGILHDPWKRIHMGVTAENVAERYGITREMQDEL
ALESQRRAANAIAAGYFKEQIVPVEVSSRRGAVLFDTDEHVRADMTAEALVKMKPVFKKE
GGTVTAGNASGINDGAAALVLAEAGRAAALGLRPLARLVGYAHAGVEPEYMGIGPVPATQ
QVLKRCGLSIKDLDVIEANEAFAAQAYAVIRELDLDPAKVNPNGSGISLGHPVGATGAII
ITKAIAELHRTGGRYALVTMCIGGGQGIAAIFERL
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgacacagcgtgaagtggtcgtcgtcggcgcggccagaacggcgatcggaaccttcggg
ggctcgctgcgggatgttcccctgacccggctgggcaccgtcgccgtcgaggcggcgctc
aagcgctcgggggtgaatccgcaggaggtggggcacgtcgtaatgggcaacgtgattccg
accgagccgcgtgacgcctacctcagccgggtcgccgcgatggacgccggggtcccgaag
gagacgcccgcgttcaacgtgaaccggctgtgtggctctgcgctccaagccgtggtgtcg
gcggcgcagagcattctgctgagtgataccgacatcgccatcggcggcggtgccgaaacg
atgagccgtggcgcctatctgctgcccgccagccgctggggcgcccggatgggcgacagc
caggtcgtcgactatatgaacggtatcctgcacgacccttggaagcggattcacatgggc
gtgaccgcggagaacgtcgccgaacgttatgggatcactcgcgagatgcaggacgaattg
gccttggagagtcaacgccgggcggccaatgcgatcgccgccgggtacttcaaggagcag
atcgtgccggtggaggtgtcctccaggcggggtgcggtcctgttcgacaccgacgagcac
gtgcgggcggacatgacggcggaagccctggtgaagatgaagccggtgttcaaaaaggag
ggcggcaccgtcacggcgggtaacgcttcgggcatcaacgacggtgccgctgcgctcgtc
ctggccgaggccggacgcgccgccgccctgggcctcaggccgctggcgcgtctggtcggc
tacgctcatgccggcgtcgagccggagtatatggggattggccccgtccccgcgacccag
caggtgctgaagcgatgtgggctgtcgatcaaggatctcgacgtaatcgaagccaacgag
gcgtttgccgcgcaagcctatgccgtcatccgtgagctggacctcgatccggcgaaggtc
aatccgaacggctcggggatttccctcggacatcccgtcggcgccaccggcgcgatcatc
atcacgaaggcgatcgccgagcttcaccggaccggcggccgttacgcgctggtgactatg
tgcatcggcgggggccaaggcatcgcggccatcttcgagcggctctaa

DBGET integrated database retrieval system