KEGG   Escherichia coli BL21-Gold(DE3)pLysS AG: ECBD_0091Help
Entry
ECBD_0091         CDS       T00939                                 

Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
ebd  Escherichia coli BL21-Gold(DE3)pLysS AG
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:ebd00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    ECBD_0091
Enzymes [BR:ebd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     ECBD_0091
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     ECBD_0091
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Structure
PDB: 

Jmol
Position
94930..95739
Genome map
AA seq 269 aa AA seqDB search
MPELPEVETSRRGIEPHLVGATILHAVVRNGRLRWPVSEEIYRLSDQPVLSVQRRAKYLL
LELPEGWIIIHLGMSGSLRILPEELPPEKHDHVDLVMSNGKVLRYTDPRRFGAWLWTKEL
EGHNVLTHLGPEPLSDDFNGEYLHQKCAKKKTAIKPWLMDNKLVVGVGNIYASESLFAAG
IHPDRLASSLSLAECELLARVIKAVLLRSIEQGGTTLKDFLQSDGKPGYFAQELQVYGRK
GEPCRVCGTPIVATKHAQRATFYCRQCQK
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaattacccgaagttgaaaccagccgccgcggcatagaaccgcatctcgttggt
gcaaccattcttcatgcagtggtgcgcaacggacgcttgcgctggccggtttcagaagag
atctaccgtttaagcgaccaaccagtgcttagcgtgcagcggcgggctaaatatctgctg
ctggagctgcctgagggctggattatcattcatttagggatgtctggcagcctgcgcatc
cttccagaagaacttccccctgaaaagcatgaccatgtggatttggtgatgagcaacggc
aaagtgctgcgctacaccgatccgcgccgctttggtgcctggctgtggaccaaagagctg
gaagggcataatgtgctgacccatcttggaccggagccgcttagcgacgatttcaatggt
gagtatctgcatcagaagtgcgcgaagaaaaaaacggcgattaaaccgtggctgatggat
aacaagctggtggtaggggtagggaatatctatgccagcgaatcactgtttgcggcgggg
atccatccggatcggctggcgtcatcactgtcgctggcagagtgtgaattgttagctcgg
gtgattaaagcggtgttgctgcgttcgattgagcagggtggtacaacgctgaaagatttt
ctgcaaagtgatggtaaaccgggctatttcgctcaggaattgcaggtttacgggcgaaaa
ggtgagccgtgtcgggtgtgcggtacgccgattgtggcgactaaacatgcgcagcgggca
acgttttattgtcggcagtgccagaagtaa

DBGET integrated database retrieval system