KEGG   Escherichia coli BL21-Gold(DE3)pLysS AG: ECBD_0383Help
Entry
ECBD_0383         CDS       T00939                                 

Definition
nitrite reductase (NAD(P)H), large subunit
Orthology
K00362  
nitrite reductase (NADH) large subunit [EC:1.7.1.15]
Organism
ebd  Escherichia coli BL21-Gold(DE3)pLysS AG
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Module
Dissimilatory nitrate reduction, nitrate => ammonia
Brite
KEGG Orthology (KO) [BR:ebd00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    ECBD_0383
Enzymes [BR:ebd01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.15  nitrite reductase (NADH)
     ECBD_0383
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(417649..420192)
Genome map
AA seq 847 aa AA seqDB search
MSKVRLAIIGNGMVGHRFIEDLLDKSDAANFDITVFCEEPRIAYDRVHLSSYFSHHTAEE
LSLVREGFYEKHGIKVLVGERAITINRQEKVIHSSAGRTVFYDKLIMATGSYPWIPPIKG
SDTQDCFVYRTIEDLNAIESCARRSKRGAVVGGGLLGLEAAGALKNLGIETHVIEFAPML
MAEQLDQMGGEQLRRKIESMGVRVHTSKNTLEIVQEGVEARKTMRFADGSELEVDFIVFS
TGIRPRDKLATQCGLDVAPRGGIVINDSCQTSDPDIYAIGECASWNNRVFGLVAPGYKMA
QVAVDHILGSENAFEGADLSAKLKLLGVDVGGIGDAHGRTPGARSYVYLDESKEIYKRLI
VSEDNKTLLGAVLVGDTSDYGNLLQLVLNAIELPENPDSLILPAHSGSGKPSIGVDKLPD
SAQICSCFDVTKGDLIAAINKGCHTVAALKAETKAGTGCGGCIPLVTQVLNAELAKQGIE
VNNNLCEHFAYSRQELFHLIRVEGIKTFEELLAKHGKGYGCEVCKPTVGSLLASCWNEYI
LKPEHTPLQDSNDNFLANIQKDGTYSVIPRSPGGEITPEGLMAVGRIAREFNLYTKITGS
QRLAMFGAQKDDLPEIWRQLIEAGFETGHAYAKALRMAKTCVGSTWCRYGVGDSVGLGVE
LENRYKGIRTPHKMKFGVSGCTRECSEAQGKDVGIIATEKGWNLYVCGNGGMKPRHADLL
AADIDRETLIKYLDRFMMFYIRTADKLTRTAPWLENLEGGIDYLKAVIIDDKLGLNAHLE
EEMARLREAVLCEWTETVNTPSAQTRFKHFINSDKRDPNVQMVPEREQHRPATPYERIPV
TLVEDNA
NT seq 2544 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaagtcagactcgcaattatcggtaacggtatggtcggccatcgctttatcgaa
gatcttcttgataaatctgatgcggccaactttgatattaccgttttctgtgaagaaccg
cgcatcgcttatgaccgcgtacacctctcgtcttacttctctcaccacaccgccgaagag
ctgtcgctggtgcgcgaaggcttctacgagaaacacggcatcaaagttctggtcggcgaa
cgcgctatcaccatcaaccgtcaggagaaggtgattcactccagcgccggacgtaccgtt
ttttatgacaagctgatcatggcaaccggttcctacccgtggatcccgccaatcaaaggt
tctgatactcaggactgctttgtctatcgcactattgaagacctcaacgccattgaatcc
tgcgcccgtcgcagcaaacgcggtgccgttgttggtggcggcctgttaggtctggaagcc
gcaggcgcgctgaaaaacttaggtattgaaacccacgttatcgaatttgcccctatgctg
atggcagaacagcttgatcagatgggcggcgagcagctgcgtcgcaaaatcgaaagtatg
ggcgtgcgcgttcacaccagcaaaaacacccttgagattgtgcaggaaggtgttgaagcg
cgtaaaaccatgcgttttgccgacggcagcgaactggaagtcgactttatcgtcttctct
accggtatccgtccgcgcgataagctggcaacccagtgtggtctggacgttgctccgcgt
gggggtattgtcattaatgattcctgccagacttccgatccggatatctacgccatcggt
gaatgcgcaagctggaacaaccgtgtatttggtctggtagcacctggctacaaaatggcg
caggtcgccgttgaccatattctcggtagcgaaaacgcctttgaaggtgctgaccttagc
gccaagctgaaactgctgggcgtagacgtaggcggtattggtgatgcgcacggtcgcacg
cctggcgcacgtagctacgtttacctcgacgaaagtaaagagatctacaaacgcctgatt
gtcagcgaagacaacaaaaccctgctcggtgcggtactggtgggcgataccagcgactac
ggtaacctgctgcaactggtgctgaacgctatcgaactgccggaaaacccggattccctg
atcctgccagcacactcgggtagcggcaagccgtctatcggtgttgataaactgccggac
agcgcgcaaatctgctcctgcttcgacgtcaccaaaggtgatctgattgctgccatcaac
aaaggctgccacacagttgcggcgctgaaagctgaaaccaaagcgggtactggctgcggt
ggctgtatcccgctggtcactcaggtactgaacgcggaactggcgaaacagggcatcgaa
gttaacaacaacctgtgcgaacactttgcttattcgcgtcaggaactgttccatttgatc
cgcgttgaaggcattaaaaccttcgaagaactgctggcgaaacacggcaaaggctacggt
tgtgaagtttgtaaaccaaccgtcggttcgctgctggcctcctgctggaacgaatacatt
ctgaagccggaacatactccgctgcaggattctaacgacaacttcctcgctaacatccag
aaagacggcacctactcggtgatcccgcgttctccgggcggtgaaatcaccccggaaggg
ctgatggcggtaggtcgtatcgcgcgtgaatttaatctctacaccaagatcactggctcc
cagcgtctggcgatgtttggcgcacagaaagacgatctgccggagatctggcgtcagctg
attgaagccggcttcgaaaccggtcatgcctatgcgaaagcactgcgtatggcgaaaacc
tgcgtgggtagcacctggtgccgctacggcgttggcgacagcgtcggcctcggcgtggaa
ctggaaaaccgctacaaaggcatccgtacgccgcacaaaatgaagttcggtgtctccggc
tgtacccgtgaatgttcagaagctcagggtaaagacgtgggtattatcgccactgaaaaa
ggctggaacctgtatgtttgcggtaacggcggcatgaaaccgcgtcatgcggatctgctg
gcggcggatatcgatcgcgaaacgctgatcaaatatctcgaccgcttcatgatgttctac
atccgtactgccgacaaactgacgcgtaccgcaccgtggttagaaaacctcgaaggcggc
atcgattacctgaaagcagtgatcattgacgacaaactggggctgaacgcacatctggaa
gaagagatggcgcgcctgcgtgaagcggtactgtgtgagtggactgaaacggtcaatacg
ccgtctgcgcagactcgcttcaaacacttcatcaacagcgacaagcgtgacccgaacgtg
cagatggtgccagagcgcgaacagcaccgtccggcaacgccgtatgaacgtatcccagta
actctggtggaggacaacgcatga

DBGET integrated database retrieval system