KEGG   Escherichia coli BL21-Gold(DE3)pLysS AG: ECBD_0565Help
Entry
ECBD_0565         CDS       T00939                                 

Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
ebd  Escherichia coli BL21-Gold(DE3)pLysS AG
Pathway
ebd00790  Folate biosynthesis
ebd01100  Metabolic pathways
Module
ebd_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ebd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ECBD_0565
Enzymes [BR:ebd01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     ECBD_0565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: ACT27635
JGI: ECBD_0565
UniProt: A0A140N7Z8
Structure
PDB: 

Jmol
Position
580394..581242
Genome map
AA seq 282 aa AA seqDB search
MKLFAQGTSLDLSHPHVMGILNVTPDSFSDGGTHNSLIDAVKHANLMINAGATIIDVGGE
STRPGAAEVSVEEELQRVIPVVEAIAQRFEVWISVDTSKPEVIRESAKVGAHIINDIRSL
SEPGALEAAAETGLPVCLMHMQGNPKTMQEAPKYDDVFAEVNRYFIEQIARCEQAGIAKE
KLLLDPGFGFGKNLSHNYSLLARLAEFHHFNLPLLVGMSRKSMIGQLLNVGPSERLSGSL
ACAVIAAMQGAHIIRVHDVKETVEAMRVVEATLSAKENKRYE
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgaaactctttgcccagggtacttcactggaccttagccatcctcacgtaatggggatc
ctcaacgtcacgcctgattccttttcggatggtggcacgcataactcgctgatagatgcg
gtgaaacatgcgaatctgatgatcaatgctggcgcgacgatcattgacgttggtggcgag
tccacgcgcccaggggcggcggaagttagcgttgaagaagagttgcaacgtgttattcct
gtggttgaggcaattgctcaacgcttcgaagtctggatctcggtcgatacatccaaacca
gaagtcatccgtgagtcagcgaaagttggcgctcacattattaatgatatccgctccctt
tccgaacctggcgctctggaggcggctgcagaaaccggtttaccggtttgtctgatgcat
atgcagggaaatccaaaaaccatgcaggaagctccgaagtatgacgatgtctttgcagaa
gtgaatcgctactttattgagcaaatagcacgttgcgagcaggcgggtatcgcaaaagag
aaattgttgctcgaccccggattcggtttcggtaaaaatctctcccataactattcatta
ctggcgcgcctggctgaatttcaccatttcaacctgccgctgttggtgggtatgtcacga
aaatcgatgattgggcagctgctgaacgtggggccgtccgagcgcctgagcggtagtctg
gcctgtgcggtcattgccgcaatgcaaggcgcgcacatcattcgtgttcatgacgtcaaa
gaaaccgtagaagcgatgcgggtggtggaagccactctgtctgcaaaggaaaacaaacgc
tatgagtaa

DBGET integrated database retrieval system