KEGG   Escherichia coli BL21-Gold(DE3)pLysS AG: ECBD_0648Help
Entry
ECBD_0648         CDS       T00939                                 

Definition
glucuronate isomerase (EC:5.3.1.12)
Orthology
K01812  
glucuronate isomerase [EC:5.3.1.12]
Organism
ebd  Escherichia coli BL21-Gold(DE3)pLysS AG
Pathway
Pentose and glucuronate interconversions
Metabolic pathways
Module
D-Glucuronate degradation, D-glucuronate => pyruvate + D-glyceraldehyde 3P
D-Galacturonate degradation (bacteria), D-galacturonate => pyruvate + D-glyceraldehyde 3P
Brite
KEGG Orthology (KO) [BR:ebd00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ECBD_0648
Enzymes [BR:ebd01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.12  glucuronate isomerase
     ECBD_0648
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
662764..664176
Genome map
AA seq 470 aa AA seqDB search
MTPFMTEDFLLDTEFARRLYHDYAKDQPIFDYHCHLPPQQIAEDYRFKNLYDIWLKGDHY
KWRAMRTNGVAERLCTGDASDREKFDAWAATVPHTIGNPLYHWTHLELRRPFGITGKLLS
PSTADEIWNECNELLAQDNFSARGIMQQMNVKMVGTTDDPIDSLEHHAEIAKDGSFTIKV
LPSWRPDKAFNIEQATFNDYMAKLGEVSDTDIRRFADLQTALTKRLDHFAAHGCKVSDHA
LDVVMFAEANEAELDSILARRLAGETLSEHEVAQFKTAVLVFLGAEYARRGWVQQYHIGA
LRNNNLRQFKLLGPDVGFDSINDRPMAEELSKLLSKQNEENLLPKTILYCLNPRDNEVLG
TMIGNFQGEGMPGKMQFGSGWWFNDQKDGMERQMTQLAQLGLLSRFVGMLTDSRSFLSYT
RHEYFRRILCQMIGRWVEAGEAPADINLLGEMVKNICFNNARDYFAIELN
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgactccgtttatgactgaagatttcctgttagataccgaatttgcccgccgtctgtat
cacgactacgcaaaagaccagccgattttcgattaccattgccatttgccgccgcagcag
attgcggaagactatcgttttaaaaacctgtatgacatctggctgaaaggcgatcactac
aaatggcgcgctatgcgtaccaacggtgtggccgagcgtctgtgtaccggtgatgcgtct
gaccgtgaaaaatttgacgcctgggcggcgactgttccgcacactatcggcaacccgtta
taccactggacgcacctcgaactgcgtcgtccgtttggtatcactggcaaattgctttct
ccgtcaactgccgatgaaatctggaacgaatgtaacgaactgctggcgcaggataacttc
tccgcgcgcggcatcatgcagcagatgaacgtgaaaatggtcggcaccaccgatgacccg
atcgattctctggagcatcacgcagagatcgccaaagacggctctttcaccatcaaagtg
ctgccgagctggcgtccggacaaagccttcaacatcgaacaggcgacctttaacgactac
atggcgaagctgggcgaagtttccgataccgacattcgccgctttgctgacctgcaaact
gccttgaccaaacgtctggatcacttcgccgctcacggctgtaaagtgtctgaccatgcg
ctggacgtggtgatgtttgctgaagcgaacgaagcggaactggacagcattctggcgcgc
cgtctggctggcgaaaccctgagcgagcacgaagtggcacagttcaaaactgcggtactg
gtgttccttggtgccgaatatgcacgtcgcggctgggtacagcagtaccacattggcgcg
ctgcgtaataacaacctgcgtcagttcaaactgctggggccggatgtaggctttgactcc
atcaacgaccgtccgatggcggaagagctgtctaagttgctgagcaagcagaatgaagaa
aacctgctgccgaaaaccattctctactgcctgaacccgcgcgataacgaagtgctgggc
accatgatcggtaacttccagggcgaaggtatgccgggcaaaatgcagttcggttccggc
tggtggtttaacgatcagaaagacggtatggaacgtcagatgacccaactggcgcagctc
ggtttgctgagccgctttgtcggtatgctaactgacagccgtagcttcctgtcatacacc
cgtcacgaatacttccgccgcattctgtgccagatgatcggtcgctgggtggaagcgggc
gaagcaccggcggacatcaacctgctgggcgagatggtgaaaaatatttgctttaacaat
gcgcgtgactacttcgccattgaactgaactaa

DBGET integrated database retrieval system