KEGG   Escherichia coli BL21-Gold(DE3)pLysS AG: ECBD_0920Help
Entry
ECBD_0920         CDS       T00939                                 

Definition
(GenBank) L-fucose isomerase
  KO
K01818  L-fucose/D-arabinose isomerase [EC:5.3.1.25 5.3.1.3]
Organism
ebd  Escherichia coli BL21-Gold(DE3)pLysS AG
Pathway
ebd00051  Fructose and mannose metabolism
ebd01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ebd00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    ECBD_0920
Enzymes [BR:ebd01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.3  D-arabinose isomerase
     ECBD_0920
    5.3.1.25  L-fucose isomerase
     ECBD_0920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fucose_iso_N1 Fucose_iso_N2 Fucose_iso_C
Motif
Other DBs
NCBI-ProteinID: ACT27987
JGI: ECBD_0920
UniProt: A0A140N420
Structure
PDB: 

Jmol
Position
complement(964265..966040)
Genome map
AA seq 591 aa AA seqDB search
MKINTLPKIGIRPVIDGRRMGVRESLEEQTMNMAKATATLLTEKLRHACGAAVECVISDT
CIAGMAEAAACEEKFSSQNVGLTITVTPCWCYGSETIDMDPTRPKAIWGFNGTERPGAVY
LAAALAAHSQKGIPAFSIYGHDVQDADDTSIPADVEEKLLRFARAGLAVASMKGKSYLSL
GGVSMGIAGSIVDHNFFESWLGMKVQAVDMTELRRRIDQKIYDEAELEMALAWADKNFRY
GEDENNKQYQRNAEQSRAVLRESLLMVMCIRDMMQGNSKLADIGRVEESLGYNAIAAGFQ
GQRHWTDQYPNGDTAEAILNSSFDWNGVREPFVVATENDSLNGVAMLMGHQLTGTAQVFA
DVRTYWSPEAIERVTGHKLDGLAEHGIIHLINSGSAALDGSCKQRDSEGNPTMKPHWEIS
QQEADACLAATEWCPAIHEYFRGGGYSSRFLTEGGVPFTMTRVNIIKGLGPVLQIAEGWS
VELPKDVHDILNKRTNSTWPTTWFAPRLTGKGPFTDVYSVMANWGANHGVLTIGHVGADF
ITLASMLRIPVCMHNVEETKVYRPSAWAAHGMDIEGQDYRACQNYGPLYKR
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattaatacgttaccgaaaattggtatccgcccggttattgacggtcgtcgcatg
ggtgttcgtgagtcgcttgaagaacaaacaatgaatatggcgaaagccacggccacactg
ctgaccgagaaactgcgccatgcctgcggagctgccgtcgagtgtgtcatttccgatacc
tgtatcgcgggtatggctgaagccgctgcttgcgaagaaaaattcagcagccagaatgta
ggcctcaccattacggtaacgccttgctggtgctatggcagtgaaaccatcgacatggat
ccaacccgcccgaaagccatttggggctttaacggcactgaacgtcccggcgctgtttac
ctggcagcggctctggcagctcacagccagaaaggcatcccggcattctccatttacggt
catgacgttcaggatgccgatgacacatcgattccagccgatgttgaagaaaaactgctg
cgctttgcccgcgccggtttggcagtcgccagcatgaaaggtaaaagctatctgtcgctg
ggcggcgtttcgatgggtatcgctggttccatcgttgatcacaacttctttgaatcctgg
ctgggaatgaaagtccaggcggtggatatgaccgaactgcgtcgccgtatcgatcagaag
atttacgacgaagccgaactggaaatggcgctggcctgggctgataaaaacttccgctac
ggcgaagatgaaaataacaaacagtatcaacgcaatgccgagcaaagccgcgcagttctg
cgcgaaagtttactgatggtgatgtgtatccgcgacatgatgcaaggcaacagcaaactg
gccgatattggtcgcgtggaagaatcacttggctacaacgccatcgctgcgggcttccag
ggacaacgccactggaccgatcaatatcccaatggtgacactgccgaagcgatcctcaac
agttcatttgactggaatggcgtgcgcgaaccctttgtcgtggcgaccgaaaacgacagt
cttaacggcgtggcaatgctaatgggtcaccagctcaccggcaccgctcaggtatttgcc
gatgtgcgtacctactggtcaccagaagcaattgagcgtgtaacggggcataaactcgat
ggactggcagaacacggcatcatccatttgatcaactcaggttctgctgcgctggacggt
tcctgtaaacaacgcgacagcgaaggtaacccgacgatgaagccacactgggaaatctct
cagcaagaggctgacgcttgcctcgccgctaccgaatggtgcccggcgatccacgaatac
ttccgtggcggcggttactcttcccgcttccttaccgaaggcggcgtcccgttcaccatg
actcgtgtcaacatcatcaaaggcctgggaccggtactgcaaatcgcggaaggctggagc
gtggaattgccgaaggatgtgcatgacatcctcaacaaacgcaccaactcaacctggcca
accacctggtttgcaccgcgcctcaccggtaaagggccgtttacggatgtgtactcggta
atggcgaactggggcgctaaccatggggttctgaccatcggccacgttggcgcagacttt
atcactctcgcctccatgctgcgtatcccggtatgtatgcacaacgttgaagagaccaaa
gtgtatcgtccttctgcctgggctgcgcacggcatggatattgaaggccaggattaccgc
gcttgccagaactacggtccgttgtacaagcgttaa

DBGET integrated database retrieval system