KEGG   Escherichia coli BL21-Gold(DE3)pLysS AG: ECBD_1284Help
Entry
ECBD_1284         CDS       T00939                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ebd  Escherichia coli BL21-Gold(DE3)pLysS AG
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ebd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ECBD_1284 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECBD_1284 (glk)
   00052 Galactose metabolism
    ECBD_1284 (glk)
   00500 Starch and sucrose metabolism
    ECBD_1284 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    ECBD_1284 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    ECBD_1284 (glk)
   00524 Butirosin and neomycin biosynthesis
    ECBD_1284 (glk)
Enzymes [BR:ebd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     ECBD_1284 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Structure
PDB: 

Jmol
Position
1352592..1353557
Genome map
AA seq 321 aa AA seqDB search
MTKYALVGDVGGTNARLALCDIASGEISQAKTYSGLDYPSLEAVIRVYLEEHKVEVKDGC
IAIACPITGDWVAMTNHTWAFSIAEMKKNLGFSHLEIINDFTAVSMAIPMLKKEHLIQFG
GAEPVEGKPIAVYGAGTGLGVAHLVHVDKRWVSLPGEGGHVDFAPNSEEEAIILEILRAE
IGHVSAERVLSGPGLVNLYRAIVKADNRLPENLKPKDITERALADSCTDCRRALSLFCVI
MGRFGGNLALNLGTFGGVFIAGGIVPRFLEFFKASGFRAAFEDKGRFKEYVHDIPVYLIV
HDNPGLLGSGAHLRQTLGHIL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagtatgcattagtcggtgatgtgggcggcaccaacgcacgtcttgctctgtgt
gatattgccagtggtgaaatctcgcaggctaagacctattcagggcttgattaccccagc
ctcgaagcggtcattcgcgtttatcttgaagaacataaggtcgaggtgaaagacggctgt
attgccatcgcttgcccaattaccggtgactgggtggcgatgaccaaccatacctgggcg
ttctcaattgccgaaatgaaaaagaatctcggttttagccatctggaaattattaacgat
tttaccgctgtatcgatggcgatcccgatgctgaaaaaagagcatctgattcagtttggt
ggcgcagaaccggtcgaaggtaagcctattgcggtttacggtgccggaacggggcttggg
gttgcgcatctggtccatgtcgataagcgttgggtaagcttgccaggcgaaggcggtcac
gttgattttgcgccgaatagtgaagaagaggccattatcctcgaaatattgcgtgcggaa
attggtcatgtttcggcggagcgcgtgctttctggccctgggctggtgaatttgtatcgc
gcaattgtgaaagctgacaaccgcctgccagaaaatctcaagccaaaagatattaccgaa
cgcgcgctggctgacagctgcaccgattgccgccgcgcattgtcgctgttttgcgtcatt
atgggccgttttggcggcaatctggcgctcaatctcgggacatttggcggcgtgtttatt
gcgggcggtatcgtgccgcgcttccttgagttcttcaaagcctccggtttccgtgccgca
tttgaagataaagggcgctttaaagaatatgtccatgatattccggtgtatctcatcgtc
catgacaatccgggccttctcggttccggtgcacatttacgccagaccttaggtcacatt
ctgtaa

DBGET integrated database retrieval system