KEGG   Escherichia coli BL21-Gold(DE3)pLysS AG: ECBD_1393Help
Entry
ECBD_1393         CDS       T00939                                 

Definition
isochorismate synthase
Orthology
K02552  
menaquinone-specific isochorismate synthase [EC:5.4.4.2]
Organism
ebd  Escherichia coli BL21-Gold(DE3)pLysS AG
Pathway
Ubiquinone and other terpenoid-quinone biosynthesis
Biosynthesis of siderophore group nonribosomal peptides
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ebd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    ECBD_1393
  Metabolism of terpenoids and polyketides
   01053 Biosynthesis of siderophore group nonribosomal peptides
    ECBD_1393
Enzymes [BR:ebd01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.4  Transferring hydroxy groups
    5.4.4.2  isochorismate synthase
     ECBD_1393
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Structure
PDB: 

Jmol
Position
1469087..1470382
Genome map
AA seq 431 aa AA seqDB search
MQSLTTALENLLRHLSQEIPATPGIRVIDIPFPLKDAFDALSWLASQQTYPQFYWQQRNG
DEEAVVLGAITRFTSLDQAQRFLRQHPEHADLRIWGLNAFDPSQGNLLLPRLEWRRCGGK
ATLRLTLFSESSLQHDAIQAKEFIATLVSIKPLPGLHLTTTREQHWPDKTGWTQLIELAT
KTIAEGELDKVVLARATDLHFASPVNAAAMMAASRRLNLNCYHFYMAFDGENAFLGSSPE
RLWRRRDKALRTEALAGTVANNPDDKQAQQLGEWLMADDKNQRENMLVVEDICQRLQADT
QTLDVLPPQVLRLRKVQHLRRCIWTSLNKADDVICLHQLQPTAAVAGLPRDLARQFIARH
EPFTREWYAGSAGYLSLQQSEFCVSLRSAKISGNVVRLYAGAGIVRGSDPEQEWQEIDNK
AAGLRTLLQME
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
gtgcaatcacttactacggcgctggaaaatctactgcgccatttgtcgcaagagattccg
gcgacacccggcattcgggttatcgatattcctttccctctcaaagacgcttttgatgcc
ttgagctggctggccagtcagcaaacatacccgcaattctactggcaacaacgtaatggt
gatgaagaagctgtcgtcctgggcgcgattacccgttttacgtcgttggaccaggcacaa
cgttttcttcgccagcacccggaacacgccgacttacgcatttgggggctgaatgctttt
gacccgtcgcagggcaatttacttttaccccgcctggaatggcgacgctgtggcggtaaa
gccacgctgcggctgacgctattcagcgaaagctcccttcagcacgatgcgattcaggca
aaagaatttatcgccacactggtgagtatcaagcccttgcctgggttacatttaaccacc
acgcgagaacaacactggccggacaaaacgggctggacgcaattaatcgaactggcaacg
aaaaccatcgccgaaggtgagctcgacaaagtggtgctcgctcgggcaactgacctgcat
ttcgcaagtccggtcaacgcggcggcgatgatggctgccagtcgtcgactgaatctgaat
tgctaccatttttacatggcctttgatggcgaaaatgcttttcttggctcttcaccggaa
cggttatggcggcggcgtgacaaagcgctgcgtactgaagcgctggcgggaacagtagca
aataatcctgatgataagcaggcgcagcagttaggagagtggctgatggcggatgataaa
aaccagcgcgagaacatgctggtggtggaagatatctgtcaacgattacaggccgatacc
cagacgctggatgttttaccgccgcaggtactgcgtctgcgtaaagtgcagcatcttcgc
cgctgtatctggacttcactcaacaaagcggatgatgtgatctgtttacatcagttgcag
ccaacggcagcagttgctggcttaccgcgcgatctggcgcgacagtttatcgcccgtcac
gaaccgttcacccgagaatggtacgccggttctgcgggctatctctcattacaacaaagc
gaattctgcgtttccctgcgctcagcaaaaattagcggcaatgtcgtgcgattatatgct
ggcgcgggcattgtccgtggttccgaccccgagcaagagtggcaggaaatcgacaacaaa
gcggcagggctgcgtactttattacaaatggaatag

DBGET integrated database retrieval system