KEGG   Escherichia coli BL21-Gold(DE3)pLysS AG: ECBD_1613Help
Entry
ECBD_1613         CDS       T00939                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase subunit GalF
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ebd  Escherichia coli BL21-Gold(DE3)pLysS AG
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:ebd00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ebd00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ebd00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ebd00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1726449..1727342
Genome map
AA seq 297 aa AA seqDB search
MTNLKAVIPVAGLGMHMLPATKAIPKEMLPIVDKPMIQYIVDEIVAAGIKEILLVTHASK
NAVENHFDTSYELESLLEQRVKRQLLAEVQSICPPGVTIMNVRQGEPLGLGHSILCARPA
IGDNPFVVVLPDVVIDDASADPLRYNLAAMIARFNETGRSQVLAKRMPGDLSEYSVIQTK
EPLDREGKVSRIVEFIEKPDQPQTLDSDIMAVGRYVLSADIWPELERTQPGAWGRIQLTD
AIAELAKKQSVDAMLMTGDSYDCGKKMGYMQAFVKYGLRNLKEGAKFRKGIEKLLSE
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatttaaaagcagttattcctgtagcgggtcttgggatgcatatgttgcctgcc
actaaggcgattcccaaagagatgctaccgatcgtcgacaagccaatgattcagtacatc
gttgacgagattgtggctgcagggatcaaagaaatcctcctggtaactcacgcttccaag
aacgcggtcgaaaaccacttcgacacctcttatgaattagaatctctccttgaacagcgc
gtgaagcgtcaactgctggcggaagtacagtccatttgcccgccgggcgtgacaattatg
aacgtgcgtcagggcgaacctttaggtttgggccactccattttatgtgcacgacctgcc
attggtgacaatccatttgtcgtggtgctgccagacgttgtgatcgacgacgccagcgcc
gacccgctgcgctacaaccttgctgccatgattgcgcgcttcaacgaaacgggccgcagc
caggtgctggcaaaacgtatgccgggtgacctctctgaatactctgtcatccagaccaaa
gagccgctggaccgcgaaggtaaagtcagccgcattgttgaattcatcgaaaaaccggat
cagccgcagacgctggactcagacatcatggccgttggtcgctatgtgctttctgcagat
atttggccggaacttgaacgcactcagcctggtgcatgggggcgtattcagctgactgat
gccatcgctgaactggcgaaaaaacagtccgttgatgccatgctgatgacaggtgacagc
tacgactgcggtaaaaaaatggggtatatgcaggcatttgtgaagtatggactacgcaac
ctgaaagaaggggcgaagttccgtaaagggattgagaagctgttaagcgagtaa

DBGET integrated database retrieval system