KEGG   Escherichia coli BL21-Gold(DE3)pLysS AG: ECBD_1617Help
Entry
ECBD_1617         CDS       T00939                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
ebd  Escherichia coli BL21-Gold(DE3)pLysS AG
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:ebd00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:ebd00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1730641..1731186
Genome map
AA seq 181 aa AA seqDB search
MNVIKTEIPDVLIFEPKVFGDERGFFMESFNQKVFEEAVGRKVEFVQDNHSKSTKGVIRG
LHFQLPPYSQAKLVRCVVGEVYDVVVDIRKDSKTFGKWVGVNLSAENKRQLWIPEGFAHG
FEVISEVAHFLYKTNNYYNATMEKGIRWDDEYLAINWKEKKAIISEKDMKQPSFRELFEK
V
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtaattaaaactgaaattcctgatgtattaatatttgaaccaaaagtatttggg
gatgagcgtggtttttttatggaaagcttcaatcagaaagttttcgaagaagctgtgggg
cggaaggttgaatttgttcaggataaccattctaagtctactaaaggagtaattagagga
ttacattttcaattaccaccttattcacaggcaaaattagtacgctgtgtagtaggtgag
gtatatgacgttgttgttgatataaggaaagattctaaaacttttggcaaatgggtcggt
gtaaatctttctgctgaaaacaaacgacagttgtggattccagaaggattcgcccatggt
tttgaagtgattagtgaagttgctcattttttatacaaaacaaataattattataatgca
actatggaaaaaggtataagatgggatgatgaatatttagctattaattggaaagaaaaa
aaagcgataatctctgagaaagacatgaaacaaccatcattcagagaactttttgagaaa
gtttaa

DBGET integrated database retrieval system