KEGG   Escherichia coli BL21-Gold(DE3)pLysS AG: ECBD_1755Help
Entry
ECBD_1755         CDS       T00939                                 

Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
ebd  Escherichia coli BL21-Gold(DE3)pLysS AG
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:ebd00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    ECBD_1755
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    ECBD_1755
Enzymes [BR:ebd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     ECBD_1755
Two-component system [BR:ebd02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   ECBD_1755
Bacterial motility proteins [BR:ebd02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    ECBD_1755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1868060..1869109
Genome map
AA seq 349 aa AA seqDB search
MSKIRVLSVDDSALMRQIMTEIINSHSDMEMVATAPDPLVARDLIKKFNPDVLTLDVEMP
RMDGLDFLEKLMRLRPMPVVMVSSLTGKGSEVTLRALELGAIDFVTKPQLGIREGMLAYS
EMIAEKVRTAAKASLAAHKPLSAPTTLKAGPLLSSEKLIAIGASTGGTEAIRHVLQPLPL
SSPALLITQHMPPGFTRSFADRLNKLCQIGVKEAEDGERVLPGHAYIAPGDRHMELARSG
ANYQIKIHDGPAVNRHRPSVDVLFHSVAKQAGRNAVGVILTGMGNDGAAGMLAMRQAGAW
TLAQNEASCVVFGMPREAINMGGVCEVVDLSQVSQQMLAKISAGQAIRI
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaatcagggtgttatctgtcgatgattcggcactgatgcgccagatcatgaca
gaaatcatcaacagccatagcgacatggaaatggtggcgaccgcgcctgatccgctggtc
gcgcgtgacttgattaagaaattcaatcccgatgtgctgacgctggatgttgaaatgccg
cggatggacggactggatttcctcgaaaaattaatgcgtttgcgtccaatgcccgtagtg
atggtttcttccctgaccggcaaagggtcagaagtcacgctgcgcgcgctggagctgggg
gcgatagattttgtcaccaaaccgcaactgggtattcgcgaaggaatgctggcgtatagc
gaaatgattgctgaaaaggtgcgtacagcagcaaaggcgagccttgcagcacataagcca
ttgtcggcaccgacaacgctgaaggcagggccgttgttgagttctgaaaaactgattgcg
attggtgcttcaacgggtggaactgaggcaattcgtcacgtactgcaaccgttgccgctt
tccagcccggcactgttaattacccagcatatgccgcctggtttcacccgctcttttgcc
gacagacttaataagctttgtcagatcggggttaaagaagccgaagacggagaacgtgtt
ttgccggggcatgcctatatcgcgccgggcgatcggcatatggagctggcgcgtagtggc
gcaaattaccaaatcaaaattcatgatggcccggcggttaaccgtcatcggccttcggta
gatgtgttgttccattctgtcgccaaacaggcggggcgtaatgcggttggggtgatcctg
accggtatgggcaacgacggcgcggcaggaatgttggcgatgcgtcaggcgggggcatgg
acccttgcgcaaaacgaagcaagttgcgtggtgttcggcatgccgcgcgaggccatcaat
atgggtggtgtctgcgaagtggtcgatcttagccaggtaagccagcaaatgttggcaaaa
attagtgccggacaggcgatacgtatttaa

DBGET integrated database retrieval system