KEGG   Escherichia coli BL21-Gold(DE3)pLysS AG: ECBD_2040Help
Entry
ECBD_2040         CDS       T00939                                 

Definition
short chain dehydrogenase
Orthology
K13938  
dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.- 1.5.1.3]
Organism
ebd  Escherichia coli BL21-Gold(DE3)pLysS AG
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ebd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ECBD_2040
   00670 One carbon pool by folate
    ECBD_2040
Enzymes [BR:ebd01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     ECBD_2040
    1.5.1.-  
     ECBD_2040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2155488..2156210)
Genome map
AA seq 240 aa AA seqDB search
MGKTQPLPILITGGGRRIGLALAWHFINQKQPVIVSYRTHYPAIDGLINAGAQCIQADFS
TNDGVMAFADEVLKSTHGLRAILHNASAWMAEKPGAPLADVLACMMQIHVNTPYLLNHAL
ERLLRGHGHAASDIIHFTDYVVERGSDKHIAYAASKAALDNMTRSFARKLAPEVKVNSIA
PSLILFNEHDDAEYRQQALNKSLMKTAPGEKEVIDLVDYLLTSCFVTGRSFPLDGGRHLR
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaaacccagcccttgccaatattaattactggcggaggtcgtcgcatcggcctc
gccctcgcatggcatttcattaatcaaaagcaaccggtgattgtcagctatcggacacac
tatccagccattgatggactgattaatgcaggtgcgcagtgtattcaggctgatttttcg
accaacgacggtgtgatggcgtttgccgatgaagtactaaaaagcacccatggtctgcgt
gctattttgcataacgccagtgcgtggatggcggaaaaaccgggtgcgccactggccgac
gtactggcttgcatgatgcagatccacgttaataccccatacctgctcaaccatgcgctg
gaaagattactgcgtgggcacggacacgccgccagcgatatcattcactttaccgattat
gtggtggagcgcggtagcgacaaacatattgcgtatgctgcaagcaaagcggcactggat
aatatgacccgctcgtttgcccgcaagctggcaccggaagtgaaagtgaattctattgcg
ccatcgctgatcctgtttaatgaacatgatgatgccgaatatcgacaacaggcgctgaat
aaatcactgatgaaaaccgcgcctggcgagaaagaagtgatcgacctggtcgattactta
cttaccagttgctttgtcaccggacgcagtttcccacttgatggcggtcgtcatctgcgt
taa

DBGET integrated database retrieval system