KEGG   Escherichia coli BL21-Gold(DE3)pLysS AG: ECBD_2908Help
Entry
ECBD_2908         CDS       T00939                                 

Gene name
lacI
Definition
lac repressor
Organism
ebd  Escherichia coli BL21-Gold(DE3)pLysS AG
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(3032567..3033658)
Genome map
AA seq 363 aa AA seqDB search
MVNVKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAELNYIPNRVAQQLA
GKQSLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGVEACKAAVHNLLAQ
RVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSIIFSHEDGTRLGVEHLVAL
GHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSAMSGFQQTMQMLNEGI
VPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSCYIPPLTTIKQDFRLLG
QTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTASPRALADSLMQLARQVSRLE
SGQ
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
gtggtgaatgtgaaaccagtaacgttatacgatgtcgcagagtatgccggtgtctcttat
cagaccgtttcccgcgtggtgaaccaggccagccacgtttctgcgaaaacgcgggaaaaa
gtggaagcggcgatggcggagctgaattacattcccaaccgcgtggcacaacaactggcg
ggcaaacagtcgttgctgattggcgttgccacctccagtctggccctgcacgcgccgtcg
caaattgtcgcggcgattaaatctcgcgccgatcaactgggtgccagcgtggtggtgtcg
atggtagaacgaagcggcgtcgaagcctgtaaagcggcggtgcacaatcttctcgcgcaa
cgcgtcagtgggctgatcattaactatccgctggatgaccaggatgccattgctgtggaa
gctgcctgcactaatgttccggcgttatttcttgatgtctctgaccagacacccatcaac
agtattattttctcccatgaagacggtacgcgactgggcgtggagcatctggtcgcattg
ggtcaccagcaaatcgcgctgttagcgggcccattaagttctgtctcggcgcgtctgcgt
ctggctggctggcataaatatctcactcgcaatcaaattcagccgatagcggaacgggaa
ggcgactggagtgccatgtccggttttcaacaaaccatgcaaatgctgaatgagggcatc
gttcccactgcgatgctggttgccaacgatcagatggcgctgggcgcaatgcgcgccatt
accgagtccgggctgcgcgttggtgcggatatctcggtagtgggatacgacgataccgaa
gacagctcatgttatatcccgccgttaaccaccatcaaacaggattttcgcctgctgggg
caaaccagcgtggaccgcttgctgcaactctctcagggccaggcggtgaagggcaatcag
ctgttgcccgtctcactggtgaaaagaaaaaccaccctggcgcccaatacgcaaaccgcc
tctccccgcgcgttggccgattcattaatgcagctggcacgacaggtttcccgactggaa
agcgggcagtga

DBGET integrated database retrieval system