KEGG   Escherichia coli BL21-Gold(DE3)pLysS AG: ECBD_2934Help
Entry
ECBD_2934         CDS       T00939                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ebd  Escherichia coli BL21-Gold(DE3)pLysS AG
Pathway
ebd00020  Citrate cycle (TCA cycle)
ebd00310  Lysine degradation
ebd01100  Metabolic pathways
ebd01110  Biosynthesis of secondary metabolites
ebd01120  Microbial metabolism in diverse environments
ebd01130  Biosynthesis of antibiotics
ebd01200  Carbon metabolism
Module
ebd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ebd_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ebd00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ECBD_2934
  Amino acid metabolism
   00310 Lysine degradation
    ECBD_2934
Enzymes [BR:ebd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     ECBD_2934
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Rhamnogal_lyase
Motif
Other DBs
NCBI-ProteinID: ACT29949
JGI: ECBD_2934
UniProt: A0A140NDX4
Structure
PDB: 

Jmol
Position
complement(3061076..3062293)
Genome map
AA seq 405 aa AA seqDB search
MSSVDILVPDLPESVADATVATWHKKPGDAVVRDEVLVEIETDKVVLEVPASADGILDAV
LEDEGTTVTSRQILGRLREGNSAGKETSAKSEEKASTPAQRQQASLEEQNNDALSPAIRR
LLAEHNLDASAIKGTGVGGRLTREDVEKHLAKAPAKESAPAAAAPAAQPALAARSEKRVP
MTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGEAFEKRHGIRLGFMSFYVK
AVVEALKRYPEVNASIDGDDVVYHNYFDVSMAVSTPRGLVTPVLRDVDTLGMADIEKKIK
ELAVKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPMAVNG
QVEILPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTRLLLDV
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcgtagatattctggtccctgacctgcctgaatccgtagccgatgccaccgtc
gcaacctggcataaaaaacccggcgacgcagtcgtacgtgatgaagtgctggtagaaatc
gaaactgacaaagtggtactggaagtaccggcatcagcagacggcattctggatgcggtt
ctggaagatgaaggtacaaccgtaacgtctcgtcagatccttggtcgcctgcgtgaaggc
aacagcgccggtaaagaaaccagcgccaaatctgaagagaaagcgtccactccggcgcaa
cgccagcaggcgtctctggaagagcaaaacaacgatgcgttaagcccggcgatccgtcgc
ctgctggctgaacacaatctcgacgccagcgccattaaaggcaccggtgtgggtggtcgt
ctgactcgtgaagatgtggaaaaacatctggcgaaagccccggcgaaagagtctgctccg
gcagcggctgctccggcggcgcaaccggctctggctgcacgtagtgaaaaacgtgtcccg
atgactcgcctgcgtaagcgtgtggcagagcgtctgctggaagcgaaaaactccaccgcc
atgctgaccacgttcaacgaagtcaacatgaagccgattatggatctgcgtaagcagtac
ggtgaagcgtttgaaaaacgccacggcatccgtctgggctttatgtccttctacgtgaaa
gcggtggttgaagccctgaaacgttacccggaagtgaacgcgtctatcgacggcgatgac
gtggtttaccacaactatttcgacgtcagcatggcggtttctacgccgcgcggcctggtg
acaccggtactgcgtgatgtcgataccctcggcatggcagacatcgagaagaaaatcaaa
gagctggcagtcaaaggccgtgacggcaagctgaccgttgaagatctgaccggtggtaac
ttcaccatcaccaacggtggtgtgttcggttccctgatgtctacgccgatcatcaacccg
ccgcagagcgcaattctgggtatgcacgctatcaaagatcgtccgatggcggtgaatggt
caggttgagatcctgccgatgatgtacctggcgctgtcctacgatcaccgtctgatcgat
ggtcgcgaatccgtgggcttcctggtaacgatcaaagagttgctggaagatccgacgcgt
ctgctgctggacgtgtag

DBGET integrated database retrieval system