KEGG   Escherichia coli BL21-Gold(DE3)pLysS AG: ECBD_2938Help
Entry
ECBD_2938         CDS       T00939                                 

Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
ebd  Escherichia coli BL21-Gold(DE3)pLysS AG
Pathway
ebd00020  Citrate cycle (TCA cycle)
ebd00190  Oxidative phosphorylation
ebd00650  Butanoate metabolism
ebd01100  Metabolic pathways
ebd01110  Biosynthesis of secondary metabolites
ebd01120  Microbial metabolism in diverse environments
ebd01130  Biosynthesis of antibiotics
ebd01200  Carbon metabolism
Module
ebd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ebd_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ebd_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ebd00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ECBD_2938
   00650 Butanoate metabolism
    ECBD_2938
  Energy metabolism
   00190 Oxidative phosphorylation
    ECBD_2938
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: ACT29953
JGI: ECBD_2938
UniProt: A0A140NCH7
Structure
PDB: 

Jmol
Position
complement(3067908..3068255)
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGVHDFILVRATAIVLTLYIIYMVGFFATSGELTYEVWIGFFASAFTKVF
TLLALFSILIHAWIGMWQVLTDYVKPLALRLMLQLVIVVALVVYVIYGFVVVWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaacgcctccgcattaggacgcaatggcgtacatgatttcatcctcgttcgc
gctaccgctatcgtcctgacgctctacatcatttatatggtcggttttttcgctaccagt
ggcgagctgacatatgaagtctggatcggtttcttcgcctctgcgttcaccaaagtgttc
accctgctggcgctgttttctatcttgatccatgcctggatcggcatgtggcaggtgttg
accgactacgttaaaccgctggctttgcgcctgatgctgcaactggtgattgtcgttgca
ctggtggtttacgtgatttatggattcgttgtggtgtggggtgtgtga

DBGET integrated database retrieval system