KEGG   Escherichia coli BL21-Gold(DE3)pLysS AG: ECBD_3292Help
Entry
ECBD_3292         CDS       T00939                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
ebd  Escherichia coli BL21-Gold(DE3)pLysS AG
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:ebd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ECBD_3292
Enzymes [BR:ebd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     ECBD_3292
Exosome [BR:ebd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ECBD_3292
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3426770..3427744
Genome map
AA seq 324 aa AA seqDB search
MTDLIQRPRRLRKSPALRAMFEETTLSLNDLVLPIFVEEEIDDYKAVEAMPGVMRIPEKH
LAREIERIANAGIRSVMTFGISHHTDETGSDAWREDGLVARMSRICKQTVPEMIVMSDTC
FCEYTSHGHCGVLCEHGVDNDATLENLGKQAVVAAAAGADFIAPSAAMDGQVQAIRQALD
AAGFKDTAIMSYSTKFASSFYGPFREAAGSALKGDRKSYQMNPMNRREAIRESLLDEAQG
ADCLMVKPAGAYLDIVRELRERTELPIGAYQVSGEYAMIKFAALAGAIDEEKVVLESLGS
IKRAGADLIFSYFAMDLAEKKILR
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgacagacttaatccaacgccctcgtcgcctgcgcaaatctcctgcgctgcgcgctatg
tttgaagagacaacacttagccttaacgacctggtgttgccgatctttgttgaagaagaa
attgacgactacaaagccgttgaagccatgccaggtgtgatgcgcattccagagaaacat
ctggcacgcgaaattgaacgcatcgccaacgccggtattcgttccgtgatgactttcggc
atctctcaccataccgatgaaaccggcagcgatgcctggcgggaagatggactggtggcg
cgaatgtcgcgcatctgcaagcagaccgtgccagaaatgatcgtcatgtcagacacctgc
ttctgcgaatacacatctcacggtcactgcggtgtgctgtgcgagcatggcgtcgacaac
gacgcgactctggaaaatttaggcaagcaagccgtggttgcagctgctgcaggcgcagac
ttcatcgccccttctgccgcgatggacggccaggtacaggcgattcgccaggcgctggac
gctgcgggctttaaagatacggcgattatgtcgtattcgaccaagttcgcctcttccttt
tatggtccgttccgtgaagctgccggaagcgcattaaaaggcgaccgcaaaagctatcag
atgaacccaatgaaccgtcgtgaggcgattcgtgagtcactgctggatgaagcccagggc
gcagactgtctgatggttaaacctgccggagcgtacctcgacatcgtgcgtgagctgcgt
gaacgtactgaattgccgattggcgcgtatcaggtgagcggtgagtacgcgatgattaag
ttcgccgcgctggcgggtgctatagatgaagagaaagtcgtgctcgaaagcttaggttca
attaagcgtgcgggtgcggatctgattttcagctactttgcgatggatttggctgagaag
aagattctgcgttaa

DBGET integrated database retrieval system