KEGG   Escherichia coli BL21-Gold(DE3)pLysS AG: ECBD_3446Help
Entry
ECBD_3446         CDS       T00939                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
ebd  Escherichia coli BL21-Gold(DE3)pLysS AG
Pathway
ebd00900  Terpenoid backbone biosynthesis
ebd01100  Metabolic pathways
ebd01110  Biosynthesis of secondary metabolites
ebd01130  Biosynthesis of antibiotics
Module
ebd_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:ebd00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ECBD_3446
Enzymes [BR:ebd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     ECBD_3446
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C Av_adeno_fibre
Motif
Other DBs
NCBI-ProteinID: ACT30446
JGI: ECBD_3446
UniProt: A0A140NDD6
Structure
PDB: 

Jmol
Position
complement(3584824..3586020)
Genome map
AA seq 398 aa AA seqDB search
MKQLTILGSTGSIGCSTLDVVRHNPEHFRVVALVAGKNVTRMVEQCLEFSPRYAVMDDEA
SAKLLKTMLQQQGSRTEVLSGQQAACDMAALEDVDQVMAAIVGAAGLLPTLAAIRAGKTI
LLANKESLVTCGRLFMDAVKQSKAQLLPVDSEHNAIFQSLPQPIQHNLGYADLEQNGVVS
ILLTGSGGPFRETPLRDLATMTPDQACRHPNWSMGRKISVDSATMMNKGLEYIEARWLFN
ASASQMEVLIHPQSVIHSMVRYQDGSVLAQLGEPDMRTPIAHTMAWPNRVNSGVKPLDFC
KLSALTFAAPDYDRYPCLKLAMEAFEQGQAATTALNAANEITVAAFLAQQIRFTDIAALN
LSVLEKMDMREPQCVDDVLSVDANAREVARKEVMRLAS
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaactcaccattctgggctcgaccggctcgattggttgcagcacgctggacgtg
gtgcgccataatcccgaacacttccgcgtagttgcgctggtggcaggcaaaaatgtcact
cgcatggtagaacagtgcctggaattctctccccgctatgccgtaatggacgatgaagcg
agtgcgaaacttcttaaaacgatgctacagcaacagggtagccgcaccgaagtcttaagt
gggcaacaagccgcttgcgatatggcagcgcttgaggatgttgatcaggtgatggcagcc
attgttggcgctgctgggctgttacctacgcttgctgcgatccgcgcgggtaaaaccatt
ttgctggccaataaagaatcactggttacctgcggacgtctgtttatggacgccgtaaag
cagagcaaagcgcaattgttaccggtcgatagcgaacataacgccatttttcagagttta
ccgcaacctatccagcataatctgggatacgctgaccttgagcaaaatggcgtggtgtcc
attttacttaccgggtctggtggccctttccgtgagacgccattgcgcgatttggcaaca
atgacgccggatcaagcctgccgtcatccgaactggtcgatggggcgtaaaatttctgtc
gattcggctaccatgatgaacaaaggtctggaatacattgaagcgcgttggctgtttaac
gccagcgccagccagatggaagtgctgattcacccgcagtcagtgattcactcaatggtg
cgctatcaggacggcagtgttctggcgcagctgggggaaccggatatgcgtacgccaatt
gcccacaccatggcatggccgaatcgcgtgaactctggcgtgaagccgctcgatttttgc
aaactaagtgcgttgacatttgccgcaccggattatgatcgttatccatgcctgaaactg
gcgatggaggcgttcgaacaaggccaggcagcgacgacagcattgaatgccgcaaacgaa
atcaccgttgctgcttttcttgcgcaacaaatccgctttacggatatcgctgcgttgaat
ttatccgtactggaaaaaatggatatgcgcgaaccacaatgtgtggacgatgtgttatct
gttgatgcgaacgcgcgtgaagtcgccagaaaagaggtgatgcgtctcgcaagctga

DBGET integrated database retrieval system