KEGG   Escherichia coli BL21-Gold(DE3)pLysS AG: ECBD_3777Help
Entry
ECBD_3777         CDS       T00939                                 

Definition
DNA polymerase III subunit chi (EC:2.7.7.7)
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
ebd  Escherichia coli BL21-Gold(DE3)pLysS AG
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:ebd00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:ebd00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:ebd03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:ebd03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ebd03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3946795..3947238
Genome map
AA seq 147 aa AA seqDB search
MKNATFYLLDNDTTIDGLSAVEQLVCEIAAERWRSGKRVLIACEDEKQAYRLDEALWARP
AESFVPHNLAGEGPRGGAPVEIAWPQKRSSSPRDILISLRTSFADFATAFTEVVDFVPYE
DSLKQLARERYKAYRVAGFNLNTATWK
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgcaacgttctaccttctggacaatgacaccaccatcgatggcttaagcgcc
gttgagcagctggtgtgtgaaattgccgcagaacgttggcgcagcggtaagcgcgtgctc
atcgcctgtgaagatgaaaagcaggcttaccggctggatgaagccctgtgggcgcgtccg
gcagaaagctttgttccgcataatttagcgggagaaggaccgcgcggcggtgcgccggtg
gagatcgcctggccgcaaaaacgcagcagcagcccgcgcgatatattgattagtctgcga
acaagctttgcagattttgccaccgctttcacagaagtggtagacttcgttccttatgaa
gattctctgaaacaactggcgcgcgaacgctataaagcctaccgcgtggctggtttcaac
ctgaatacggcaacctggaaataa

DBGET integrated database retrieval system