KEGG   Escherichia coli BL21-Gold(DE3)pLysS AG: ECBD_4179Help
Entry
ECBD_4179         CDS       T00939                                 

Definition
(GenBank) fatty oxidation complex, alpha subunit FadB
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
ebd  Escherichia coli BL21-Gold(DE3)pLysS AG
Pathway
ebd00071  Fatty acid degradation
ebd00280  Valine, leucine and isoleucine degradation
ebd00281  Geraniol degradation
ebd00310  Lysine degradation
ebd00362  Benzoate degradation
ebd00380  Tryptophan metabolism
ebd00410  beta-Alanine metabolism
ebd00640  Propanoate metabolism
ebd00650  Butanoate metabolism
ebd00903  Limonene and pinene degradation
ebd00930  Caprolactam degradation
ebd01040  Biosynthesis of unsaturated fatty acids
ebd01100  Metabolic pathways
ebd01110  Biosynthesis of secondary metabolites
ebd01120  Microbial metabolism in diverse environments
ebd01130  Biosynthesis of antibiotics
ebd01200  Carbon metabolism
ebd01212  Fatty acid metabolism
Module
ebd_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ebd00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ECBD_4179
   00650 Butanoate metabolism
    ECBD_4179
  Lipid metabolism
   00071 Fatty acid degradation
    ECBD_4179
   01040 Biosynthesis of unsaturated fatty acids
    ECBD_4179
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ECBD_4179
   00310 Lysine degradation
    ECBD_4179
   00380 Tryptophan metabolism
    ECBD_4179
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ECBD_4179
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ECBD_4179
   00281 Geraniol degradation
    ECBD_4179
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ECBD_4179
   00930 Caprolactam degradation
    ECBD_4179
Enzymes [BR:ebd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     ECBD_4179
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     ECBD_4179
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     ECBD_4179
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     ECBD_4179
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: ACT31161
JGI: ECBD_4179
UniProt: A0A140SS89
Position
4406026..4408215
Genome map
AA seq 729 aa AA seqDB search
MLYKGDTLYLDWLEDGIAELVFDAPGSVNKLDTATVASLGEAIGVLEQQSDLKGLLLRSN
KAAFIVGADITEFLSLFLVPEEQLSQWLHFANSVFNRLEDLPVPTIAAVNGYALGGGCEC
VLATDYRLATPDLRIGLPETKLGIMPGFGGSVRMPRMLGADSALEIIAAGKDVGADQALK
IGLVDGVVKAEKLVEGAKAVLRQAINGDLDWKAKRQPKLEPLKLSKIEATMSFTIAKGMV
AQTAGKHYPAPITAVKTIEAAARFGREEALNLENKSFVPLAHTNEARALVGIFLNDQYVK
GKAKKLTKDVETPKQAAVLGAGIMGGGIAYQSAWKGVPVVMKDINDKSLTLGMTEAAKLL
NKQLERGKIDGLKLAGVISTIHPTLDYAGFDRVDVVVEAVVENPKVKKAVLAETEQKVRQ
DTVLASNTSTIPISELANALERPENFCGMHFFNPVHRMPLVEIIRGEKSSDETIAKVVAW
ASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRKIDKVMEKQFGWPMGPAYL
LDVVGIDTAHHAQAVMAAGFPQRMQKDYRDAIDALFDANRFGQKNGLGFWRYKEDSKGKP
KKEEDAVVDDLLAEVSHAKRDFSEEEIIARMMIPMVNEVVRCLEEGIIATPAEADMALVY
GLGFPPFHGGAFRWLDTLGSAKYLDMAQQYQHLGPMYEVPEGLRNKARHNEPYYPPVEPA
RPVGDLKTA
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgctttacaaaggcgacaccctgtaccttgactggctggaagatggcattgccgaactg
gtatttgatgccccaggttcagttaataaactcgacactgcgaccgtcgccagcctcggc
gaggccatcggcgtgctggaacagcaatcagatctaaaagggctgctgctacgttcgaac
aaagcagcctttatcgtcggtgctgatatcaccgaatttttgtccctgttcctcgttcct
gaagaacagttaagtcagtggctgcactttgccaatagcgtgtttaatcgcctggaagat
ctgccggtgccgaccattgctgccgtcaatggctatgcgctgggcggtggctgcgaatgc
gtgctggcgaccgattatcgtctggcgacgccggatctgcgcatcggtctgccggaaacc
aaactgggcatcatgccgggctttggcggttctgtacgtatgccacgtatgctgggcgct
gacagtgcgctggaaatcattgccgccggtaaagatgtcggcgcggatcaggcgctgaaa
atcggtctggtggatggcgtagtcaaagcagaaaaactggttgaaggcgcaaaggcggtt
ttacgccaggccattaacggcgacctcgactggaaagcaaaacgtcagccgaagctggaa
ccactaaaactgagcaagattgaagccaccatgagcttcaccatcgctaaagggatggtc
gcacaaacagcggggaaacattatccggcccccatcaccgcagtaaaaaccattgaagct
gcggcccgttttggtcgtgaagaagccttaaacctggaaaacaaaagttttgtcccgctg
gcgcataccaacgaagcccgcgcactggtcggcattttccttaacgatcaatatgtaaaa
ggcaaagcgaagaaactcaccaaagacgttgaaaccccgaaacaggccgcggtgctgggt
gcaggcattatgggcggcggcatcgcttaccagtctgcgtggaaaggcgtgccggttgtc
atgaaagatatcaacgacaagtcgttaaccctcggcatgaccgaagccgcgaaactgctg
aacaagcagcttgagcgcggcaagatcgatggtctgaaactggctggcgtgatctccaca
atccacccaacgctcgactacgccgggtttgaccgcgtggatgttgtggtagaagcggtt
gttgaaaacccgaaagtgaaaaaagccgtactggcagaaaccgaacaaaaagtacgccag
gataccgtgctggcgtctaacacttcaaccattcctatcagcgaactggccaacgcgctg
gaacgcccggaaaacttctgcgggatgcacttctttaacccggtccaccgaatgccgttg
gtagaaattattcgcggcgagaaaagctccgacgaaaccatcgcgaaagttgtcgcctgg
gcgagcaagatgggcaagacgccgattgtggttaacgactgccccggcttctttgttaac
cgcgtgctgttcccgtatttcgccggtttcagccagctgctgcgcgacggcgcggatttc
cgcaagatcgacaaagtgatggaaaaacagtttggctggccgatggggccggcatatctg
ctggacgttgtggggattgataccgcgcatcacgctcaggcggtgatggcagcaggcttc
ccgcagcggatgcagaaagattaccgcgatgccatcgatgcgctgtttgatgccaaccgt
tttggtcagaagaacggcctcggtttctggcgttataaagaagacagtaaaggcaagccg
aagaaagaagaagacgccgtcgttgacgacctgctggcagaggtcagccacgcgaagcgc
gatttcagcgaagaagagattatcgcccgcatgatgatcccgatggtcaacgaagtggtg
cgctgtctggaagaaggcattatcgccactccagcagaagcggatatggcgctggtctac
ggactggggttccctccgttccacggcggcgcgttccgctggctggacaccctcggtagc
gcaaaatacctcgatatggcacaacaatatcagcacctcggcccgatgtatgaagtgccg
gaaggtctgcgtaataaagcgcgtcataacgaaccgtactatcccccggttgagccagcc
cgtccggttggcgacctgaaaacggcttaa

DBGET integrated database retrieval system