KEGG   Escherichia coli BL21-Gold(DE3)pLysS AG: ECBD_4213Help
Entry
ECBD_4213         CDS       T00939                                 

Definition
lysophospholipase L2 (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
ebd  Escherichia coli BL21-Gold(DE3)pLysS AG
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:ebd00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    ECBD_4213
Enzymes [BR:ebd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     ECBD_4213
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4440751..4441773)
Genome map
AA seq 340 aa AA seqDB search
MFQQQKDWETRENAFAAFTMGPLTDFWRQRDEAEFTGVDDIPVRFVRFRAQHHDRVVVIC
PGRIESYVKYAELAYDLFHLGFDVLIIDHRGQGRSGRLLADPHLGHVNRFNDYVDDLAAF
WQQEVQPGPWRKRYILAHSMGGAISTLFLQRHPGVCDAIALTAPMFGIVIRMPSFMARQI
LNWAEAHPRFRDGYAIGTGRWRALPFAINVLTHSRQRYRRNLRFYADDPTIRVGGPTYHW
VRESILAGEQVLAGAGDDATPTLLLQAEEERVVDNRMHDRFCELRTAAGHPVEGGRPLVI
KGAYHEILFEKDAMRSVALHAIVDFFNRHNSPSGNRSTEV
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgtttcagcagcaaaaagactgggaaacaagagaaaacgcgtttgctgcttttaccatg
ggaccgctgactgatttctggcgtcagcgtgatgaagcagaatttactggtgtggatgac
attccggtgcgctttgtccgttttcgcgcacagcaccatgaccgggtggtagtcatctgc
ccggggcgtattgagagctacgtaaaatatgcggaactggcctacgacctgttccatttg
gggtttgatgtcttaatcatcgaccatcgcgggcagggacgttccggtcgcctgttagcc
gatccgcatctcgggcatgttaatcgctttaatgattatgttgatgatctggcggcattc
tggcaacaggaggttcagcccggtccgtggcgtaaacgctatatactggcacattcaatg
ggcggtgcgatctccacattatttctgcaacgccatccaggtgtatgtgacgccattgcg
ctaactgcgccaatgtttgggatcgtgattcgtatgccgtcatttatggcacggcagatc
ctcaactgggccgaagcgcatccacgtttccgtgatggctatgcaataggcaccgggcgc
tggcgcgcgttgccgtttgctatcaacgtactgacccacagcagacagcgatatcgacgt
aacttacgcttctatgctgatgatccaacgattcgcgtcggtgggccgacctaccattgg
gtacgcgaaagtattctggctggcgaacaggtgttagccggtgcgggtgatgacgccacg
ccaacgcttctcttacaagctgaagaggaacgcgtggtggataaccgcatgcatgaccgt
ttttgtgaactccgcaccgctgcgggccatcctgtcgaaggaggacggccgttggtaatt
aaaggtgcgtaccatgagatcctttttgaaaaggacgcaatgcgctcagtcgcgctccac
gccatcgttgattttttcaacaggcataactcacccagcggaaaccgctctacagaggtt
taa

DBGET integrated database retrieval system