KEGG   Escherichia coli BL21-Gold(DE3)pLysS AG: ECBD_4217Help
Entry
ECBD_4217         CDS       T00939                                 

Definition
(GenBank) Phospholipase A(2)
  KO
K01058  phospholipase A1/A2 [EC:3.1.1.32 3.1.1.4]
Organism
ebd  Escherichia coli BL21-Gold(DE3)pLysS AG
Pathway
ebd00564  Glycerophospholipid metabolism
ebd00565  Ether lipid metabolism
ebd00590  Arachidonic acid metabolism
ebd00592  alpha-Linolenic acid metabolism
ebd01100  Metabolic pathways
ebd01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ebd00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    ECBD_4217
   00565 Ether lipid metabolism
    ECBD_4217
   00590 Arachidonic acid metabolism
    ECBD_4217
   00591 Linoleic acid metabolism
    ECBD_4217
   00592 alpha-Linolenic acid metabolism
    ECBD_4217
Enzymes [BR:ebd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     ECBD_4217
    3.1.1.32  phospholipase A1
     ECBD_4217
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PLA1
Motif
Other DBs
NCBI-ProteinID: ACT31199
JGI: ECBD_4217
UniProt: A0A140NHI4
Structure
PDB: 

Jmol
Position
complement(4445204..4446073)
Genome map
AA seq 289 aa AA seqDB search
MRTLQGWLLPVFMLPMAVYAQEATVKEVHDAPAVRGSIIANMLQEHDNPFTLYPYDTNYL
IYTQTSDLNKEAIASYDWAENARKDEVKFQLSLAFPLWRGILGPNSVLGASYTQKSWWQL
SNSDESSPFRETNYEPQLFLGFATDYNFAGWTLRDVEMGYNHDSNGRSDPTSRSWNRLYT
RLMAENGNWLVEVKPWYVVGNTDDNPDITKYMGYYQLKIGYHLGDAVLSAKGQYNWNTGY
GGAELGLSYPITKHVRLYTQVYSGYGESLIDYNFNQTRVGVGVMLNDLF
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgcggactctgcagggctggttgttgccggtgtttatgttgcctatggcagtatatgca
caagaggcaacggtgaaagaggtgcatgacgcgccagcggtgcgtggcagtattatcgcc
aatatgctgcaggagcatgacaatccgttcacgctctatccttatgacaccaactacctc
atctacacccaaaccagcgatctgaacaaagaagcgattgccagttacgactgggcggaa
aatgcgcgtaaggatgaagtaaagtttcagttgagcctggcgtttccgctgtggcgtggg
attttaggcccgaactcggtgttgggtgcgtcttatacgcaaaaatcctggtggcagctt
tctaatagcgatgagtcttcaccgtttcgtgaaaccaactacgaaccgcaattgttcctc
ggttttgccacggattacaactttgctggctggacgctgcgcgatgtggaaatgggctac
aaccacgactcaaacgggcgttcagacccgacttcccgcagctggaaccgcctttatacc
cgcctgatggcagaaaacggtaactggctggtagaggtgaagccgtggtatgtggtgggg
aatacggacgataacccggacatcaccaaatatatgggctattaccagcttaaaatcggc
tatcacctcggtgatgcggtactgagcgcgaaagggcagtacaactggaacaccggttac
ggtggtgcggagttaggcttaagttacccgatcaccaaacatgtgcgcctttatactcag
gtttacagtggttacggcgaatcgctcatcgactataacttcaaccagacccgcgttggt
gtgggagttatgctaaacgacctgttttga

DBGET integrated database retrieval system