KEGG   Escherichia coli BL21(DE3): B21_00309Help
Entry
B21_00309         CDS       T02096                                 

Gene name
mhpF
Definition
(GenBank) acetaldehyde dehydrogenase 2
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
ebe  Escherichia coli BL21(DE3)
Pathway
ebe00360  Phenylalanine metabolism
ebe00362  Benzoate degradation
ebe00620  Pyruvate metabolism
ebe00621  Dioxin degradation
ebe00622  Xylene degradation
ebe00650  Butanoate metabolism
ebe01100  Metabolic pathways
ebe01120  Microbial metabolism in diverse environments
ebe01220  Degradation of aromatic compounds
Module
ebe_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ebe00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    B21_00309 (mhpF)
   00650 Butanoate metabolism
    B21_00309 (mhpF)
  Amino acid metabolism
   00360 Phenylalanine metabolism
    B21_00309 (mhpF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    B21_00309 (mhpF)
   00622 Xylene degradation
    B21_00309 (mhpF)
   00621 Dioxin degradation
    B21_00309 (mhpF)
Enzymes [BR:ebe01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     B21_00309 (mhpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh F420_oxidored GFO_IDH_MocA Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: CAQ30826
UniProt: A0A140ND06
Position
342450..343400
Genome map
AA seq 316 aa AA seqDB search
MSKRKVAIIGSGNIGTDLMIKILRHGQHLEMAVMVGIDPQSDGLARARRMGVATTHEGVI
GLMNMPEFADIDIVFDATSAGAHVKNDAALREAKPDIRLIDLTPAAIGPYCVPVVNLEAN
VDQLNVNMVTCGGQATIPMVAAVSRVARVHYAEIIASIASKSAGPGTRANIDEFTETTSR
AIEVVGGAAKGKAIIVLNPAEPPLMMRDTVYVLSDEASQDDIEASINEMAEAVQAYVPGY
RLKQRVQFEVIPQDKPVNLPGVGQFSGLKTAVWLEVEGAAHYLPAYAGNLDIMTSSALAT
AEKMAQSLARKAGEAA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagcgtaaagtcgccattatcggttctggcaacattggcaccgatctgatgatt
aaaattttgcgtcacggtcagcatctggagatggcggtgatggttggcattgatcctcag
tccgacggtctggcgcgcgccagacgtatgggcgtcgccaccacccatgaaggggtgatc
ggactgatgaacatgcctgaatttgctgatatcgacattgtatttgatgcgaccagcgcc
ggtgctcatgtgaaaaacgatgccgctttacgcgaagcgaaaccggatattcgcttaatt
gacctgacgcctgctgccatcggcccttactgcgtgccggtggttaacctcgaggcgaac
gtcgatcaactgaacgtcaacatggtcacctgcggcggccaggccaccattccaatggtg
gcggcagtttcacgcgtggcgcgtgttcattacgccgaaattatcgcttctatcgccagt
aaatctgccggacctggcacgcgtgccaatatcgatgaatttacggaaaccacttcccga
gccattgaagtggtgggcggcgcggcaaaagggaaggcgattattgtgcttaacccagca
gagccaccgttgatgatgcgtgacacggtgtatgtattgagcgacgaagcttcacaagat
gatatcgaagcctcaatcaatgaaatggctgaggcggtgcaggcttacgtaccgggttat
cgcctgaaacagcgcgtgcagtttgaagttatcccgcaggataaaccggtcaatttaccg
ggcgtggggcaattctccggactgaaaacagcggtctggctggaagtcgaaggcgcagcg
cattatctgcctgcctatgcgggcaacctcgacattatgacttccagtgcgctggcgaca
gcggaaaaaatggcccagtcactggcgcgcaaggcaggagaagcggcatga

DBGET integrated database retrieval system