KEGG   Escherichia coli BL21(DE3): B21_00450Help
Entry
B21_00450         CDS       T02096                                 

Gene name
tesA
Definition
multifunctional acyl-CoA thioesterase I and protease I and lysophospholipase L1 (EC:3.1.1.5 3.1.2.2 3.1.2.14)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
ebe  Escherichia coli BL21(DE3)
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:ebe00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    B21_00450 (tesA)
Enzymes [BR:ebe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     B21_00450 (tesA)
   3.1.2  Thioester hydrolases
    3.1.2.-  
     B21_00450 (tesA)
Lipid biosynthesis proteins [BR:ebe01004]
 Fatty acid synthase
  Component type
   B21_00450 (tesA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(488280..488906)
Genome map
AA seq 208 aa AA seqDB search
MMNFNNVFRWHLPFLFLVLLTFRAAAADTLLILGDSLSAGYRMSASAAWPALLNDKWQSK
TSVVNASISGDTSQQGLARLPALLKQHQPRWVLVELGGNDGLRGFQPQQTEQTLRQILQD
VKAANAEPLLMQIRLPANYGRRYNEAFSAIYPKLAKEFDVPLLPFFMEEVYLKPQWMQDD
GIHPNRDAQPFIADWMAKQLQPLVNHDS
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacttcaacaatgttttccgctggcatttgcccttcctgttcctggtcctgtta
accttccgtgccgccgcagcggacacgttattgattctgggtgatagcctgagcgccggg
tatcgaatgtctgccagcgcggcctggcctgccttgttgaatgataagtggcagagtaaa
acgtcggtagttaatgccagcatcagcggcgacacctcgcaacaaggactggcgcgcctt
ccggctctgctgaaacagcatcagccgcgttgggtgctggttgaactgggcggcaatgac
ggtttgcgtggttttcagccacagcaaaccgagcaaacgctgcgccagattttgcaggat
gtcaaagccgccaacgctgaaccattgttaatgcaaatacgtctgcctgcaaactatggt
cgccgttataatgaagcctttagcgccatttaccccaaactcgccaaagagtttgatgtt
ccgctgctgcccttttttatggaagaggtctacctcaagccacaatggatgcaggatgac
ggtattcatcccaaccgcgacgcccagccgtttattgccgactggatggcgaagcagttg
cagcctttagtaaatcatgactcataa

DBGET integrated database retrieval system