KEGG   Escherichia coli BL21(DE3): B21_00622Help
Entry
B21_00622         CDS       T02096                                 

Gene name
asnB
Definition
asparagine synthetase B (EC:6.3.1.1 6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
ebe  Escherichia coli BL21(DE3)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ebe00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    B21_00622 (asnB)
Enzymes [BR:ebe01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     B21_00622 (asnB)
Peptidases [BR:ebe01002]
 Cysteine Peptidases
  Family C44
   B21_00622 (asnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(657381..659045)
Genome map
AA seq 554 aa AA seqDB search
MCSIFGVFDIKTDAVELRKKALELSRLMRHRGPDWSGIYASDNAILAHERLSIVDVNAGA
QPLYNQQKTHVLAVNGEIYNHQALRAEYGDRYQFQTGSDCEVILALYQEKGPEFLDDLQG
MFAFALYDSEKDAYLIGRDHLGIIPLYMGYDEHGQLYVASEMKALVPVCRTIKEFPAGSY
LWSQDGEIRSYYHRDWFDYDAVKDNVTDKNELRQALEDSVKSHLMSDVPYGVLLSGGLDS
SIISAITKKYAARRVEDQERSEAWWPQLHSFAVGLPGSPDLKAAQEVANHLGTVHHEIHF
TVQEGLDAIRDVIYHIETYDVTTIRASTPMYLMSRKIKAMGIKMVLSGEGSDEVFGGYLY
FHKAPNAKELHEETVRKLLALHMYDCARANKAMSAWGVEARVPFLDKKFLDVAMRINPQD
KMCGNGKMEKHILRECFESYLPASVAWRQKEQFSDGVGYSWIDTLKEVAAQQVSDQQLET
ARFRFPYNTPTSKEAYLYREIFEELFPLPSAAECVPGGPSVACSSAKAIEWDEAFKKMDD
PSGRAVGVHQSAYK
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgtgttcaatttttggcgtattcgatatcaaaacagacgcagttgagctgcgtaagaaa
gcactcgagctgtcacgcctgatgcgtcatcgtggcccggactggtccggtatttatgcc
agcgataacgccattctcgcccacgaacgtctgtcaattgttgacgttaacgcgggggcg
caacctctctacaaccaacaaaaaactcatgtgctggcggtaaacggtgaaatctacaac
caccaggcactgcgcgccgaatatggcgatcgttatcagttccagaccggatctgactgt
gaagtgatcctcgcgctgtatcaggaaaaagggccggaatttctcgacgacttgcagggc
atgtttgcctttgccttgtacgacagcgaaaaagatgcctacctgattggtcgcgaccat
ctggggatcatcccactgtatatgggctatgacgaacacggtcagctgtatgtggcctca
gaaatgaaagccctggtgccagtttgccgcacgattaaagagttcccggcggggagctat
ttgtggagccaggacggcgaaatccgttcttattatcatcgcgactggttcgactacgat
gcggtgaaagataacgtaaccgacaaaaacgagctgcgtcaggcacttgaagattccgtt
aaaagccatctgatgtctgatgtgccttacggtgtgctgctttctggtggtctggattcc
tcaattatttccgctatcaccaagaaatacgcagcccgtcgcgtggaagatcaggaacgc
tctgaagcctggtggccgcagttacactcctttgctgtaggtctgccgggttcaccggat
cttaaagcagcccaggaagtggcaaaccatctgggcacggtgcatcacgaaattcacttc
actgtacaggaaggtctggatgccatccgcgacgtgatttaccacatcgaaacttatgat
gtgaccacaattcgcgcttcaacaccgatgtatttaatgtcgcgtaagatcaaggcgatg
ggcattaaaatggtgctgtccggtgaaggttctgatgaagtgtttggcggttatctttac
ttccataaagcgcccaacgctaaagaactgcatgaagagacggtgcgtaaactgctggcc
ctgcatatgtatgactgcgcgcgcgccaacaaagcgatgtcagcctggggcgtggaagca
cgcgttccgttcctcgacaaaaaattccttgatgtggcgatgcgcattaacccgcaggat
aaaatgtgcggtaacggcaaaatggaaaaacacatcctgcgtgaatgttttgagtcatac
ctgcccgcaagcgtggcctggcggcagaaagagcagttctccgatggcgtcggttacagt
tggatcgacaccctgaaagaagtggcggcgcagcaggtttctgatcagcaactggaaact
gcccgcttccgcttcccgtacaacacgccaacctcaaaagaagcgtatctgtaccgggag
atctttgaagaactgttcccgcttccgagcgccgctgagtgcgtgcctggcggtccttcc
gtcgcgtgttcttccgctaaagcgatcgaatgggatgaagcgttcaagaaaatggacgat
ccatctggtcgtgcggttggtgttcaccagtcggcatataagtaa

DBGET integrated database retrieval system