KEGG   Escherichia coli BL21(DE3): B21_00671Help
Entry
B21_00671         CDS       T02096                                 

Gene name
sdhD
Definition
(RefSeq) succinate dehydrogenase membrane protein, subunit of succinate dehydrogenase (EC:1.3.5.1)
  KO
K00242  
succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
ebe  Escherichia coli BL21(DE3)
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ebe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    B21_00671 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    B21_00671 (sdhD)
   00650 Butanoate metabolism
    B21_00671 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    B21_00671 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
714124..714471
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGVHDFILVRATAIVLTLYIIYMVGFFATSGELTYEVWIGFFASAFTKVF
TLLALFSILIHAWIGMWQVLTDYVKPLALRLMLQLVIVVALVVYVIYGFVVVWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaacgcctccgcattaggacgcaatggcgtacatgatttcatcctcgttcgc
gctaccgctatcgtcctgacgctctacatcatttatatggtcggttttttcgctaccagt
ggcgagctgacatatgaagtctggatcggtttcttcgcctctgcgttcaccaaagtgttc
accctgctggcgctgttttctatcttgatccatgcctggatcggcatgtggcaggtgttg
accgactacgttaaaccgctggctttgcgcctgatgctgcaactggtgattgtcgttgca
ctggtggtttacgtgatttatggattcgttgtggtgtggggtgtgtga

DBGET integrated database retrieval system