KEGG   Escherichia coli BL21(DE3): B21_01225Help
Entry
B21_01225         CDS       T02096                                 

Gene name
adhE
Definition
acetaldehyde dehydrogenase / alcohol dehydrogenase / PFL-deactivase (EC:1.2.1.10 1.1.1.1)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
ebe  Escherichia coli BL21(DE3)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ebe00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    B21_01225 (adhE)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B21_01225 (adhE)
   00620 Pyruvate metabolism
    B21_01225 (adhE)
   00650 Butanoate metabolism
    B21_01225 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    B21_01225 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    B21_01225 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    B21_01225 (adhE)
   00626 Naphthalene degradation
    B21_01225 (adhE)
Enzymes [BR:ebe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     B21_01225 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     B21_01225 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1282231..1284906)
Genome map
AA seq 891 aa AA seqDB search
MAVTNVAELNALVERVKKAQREYASFTQEQVDKIFRAAALAAADARIPLAKMAVAESGMG
IVEDKVIKNHFASEYIYNAYKDEKTCGVLSEDDTFGTITIAEPIGIICGIVPTTNPTSTA
IFKSLISLKTRNAIIFSPHPRAKDATNKAADIVLQAAIAAGAPKDLIGWIDQPSVELSNA
LMHHPDINLILATGGPGMVKAAYSSGKPAIGVGAGNTPVVIDETADIKRAVASVLMSKTF
DNGVICASEQSVVVVDSVYDAVRERFATHGGYLLQGKELKAVQDVILKNGALNAAIVGQP
AYKIAELAGFSVPENTKILIGEVTVVDESEPFAHEKLSPTLAMYRAKDFEDAVEKAEKLV
AMGGIGHTSCLYTDQDNQPARVSYFGQKMKTARILINTPASQGGIGDLYNFKLAPSLTLG
CGSWGGNSISENVGPKHLINKKTVAKRAENMLWHKLPKSIYFRRGSLPIALDEVITDGHK
RALIVTDRFLFNNGYADQITSVLKAAGVETEVFFEVEADPTLSIVRKGAELANSFKPDVI
IALGGGSPMDAAKIMWVMYEHPETHFEELALRFMDIRKRIYKFPKMGVKAKMIAVTTTSG
TGSEVTPFAVVTDDATGQKYPLADYALTPDMAIVDANLVMDMPKSLCAFGGLDAVTHAME
AYVSVLASEFSDGQALQALKLLKEYLPASYHEGSKNPVARERVHSAATIAGIAFANAFLG
VCHSMAHKLGSQFHIPHGLANALLICNVIRYNANDNPTKQTAFSQYDRPQARRRYAEIAD
HLGLSAPGDRTAAKIEKLLAWLETLKAELGIPKSIREAGVQEADFLANVDKLSEDAFDDQ
CTGANPRYPLISELKQILLDTYYGRDYVEGETAAKKEAAPAKAEKKAKKSA
NT seq 2676 nt NT seq  +upstreamnt  +downstreamnt
atggctgttactaatgtcgctgaacttaacgcactcgtagagcgtgtaaaaaaagcccag
cgtgaatatgccagtttcactcaagagcaagtagacaaaatcttccgcgccgccgctctg
gctgctgcagatgctcgaatcccactcgcgaaaatggccgttgccgaatccggcatgggt
atcgtcgaagataaagtgatcaaaaaccactttgcttctgaatatatctacaacgcctat
aaagatgaaaaaacctgtggtgttctgtctgaagacgacacttttggtaccatcactatc
gctgaaccaatcggtattatttgcggtatcgttccgaccactaacccgacttcaactgct
atcttcaaatcgctgatcagtctgaagacccgtaacgccattatcttctccccgcacccg
cgtgcaaaagatgccaccaacaaagcggctgatatcgttctgcaggctgctatcgctgcc
ggtgctccgaaagatctgatcggctggatcgatcaaccttctgttgaactgtctaacgca
ctgatgcaccacccagacatcaacctgatcctcgcgactggtggtccgggcatggttaaa
gccgcatacagctccggtaaaccagctatcggtgtaggcgcgggcaacactccagttgtt
atcgatgaaactgctgatatcaaacgtgcagttgcatctgtactgatgtccaaaaccttc
gacaacggcgtaatctgtgcttctgaacagtctgttgttgttgttgactctgtttatgac
gctgtacgtgaacgttttgcaacccacggcggctatctgttgcagggtaaagagctgaaa
gctgttcaggatgttatcctgaaaaacggtgcgctgaacgcggctatcgttggtcagcca
gcctataaaattgctgaactggcaggcttctctgtaccagaaaacaccaagattctgatc
ggtgaagtgaccgttgttgatgaaagcgaaccgttcgcacatgaaaaactgtccccgact
ctggcaatgtaccgcgctaaagatttcgaagacgcggtagaaaaagcagagaaactggtt
gctatgggcggtatcggtcatacctcttgcctgtacactgaccaggataaccaaccggct
cgcgtttcttacttcggtcagaaaatgaaaacggcgcgtatcctgattaacaccccagcg
tctcagggtggtatcggtgacctgtataacttcaaactcgcaccttccctgactctgggt
tgtggttcttggggtggtaactccatctctgaaaacgttggtccgaaacacctgatcaac
aagaaaaccgttgctaagcgagctgaaaacatgttgtggcacaaacttccgaaatctatc
tacttccgccgtggctccctgccaatcgcgctggatgaagtgattactgatggccacaaa
cgtgcgctcatcgtgactgaccgcttcctgttcaacaatggttatgctgatcagatcact
tccgtactgaaagcagcaggcgttgaaactgaagtcttcttcgaagtagaagcggacccg
accctgagcatcgttcgtaaaggtgcagaactggcaaactccttcaaaccagacgtgatt
atcgcgctgggtggtggttccccgatggacgccgcgaagatcatgtgggttatgtacgaa
catccggaaactcacttcgaagagctggcgctgcgctttatggatatccgtaaacgtatc
tacaagttcccgaaaatgggcgtgaaagcgaaaatgatcgctgtcaccaccacttctggt
acaggttctgaagtcactccgtttgcggttgtaactgacgacgctactggtcagaaatat
ccgctggcagactatgcgctgactccggatatggcgattgtcgacgccaacctggttatg
gacatgccgaagtccctgtgtgctttcggtggtctggacgcagtaactcacgccatggaa
gcttatgtttctgtactggcatctgagttctctgatggtcaggctctgcaggcactgaaa
ctgctgaaagaatatctgccagcgtcctaccacgaagggtctaaaaatccggtagcgcgt
gaacgtgttcacagtgcagcgactatcgcgggtatcgcgtttgcgaacgccttcctgggt
gtatgtcactcaatggcgcacaaactgggttcccagttccatattccgcacggtctggca
aacgccctgctgatttgtaacgttattcgctacaatgcgaacgacaacccgaccaagcag
actgcattcagccagtatgaccgtccgcaggctcgccgtcgttatgctgaaattgccgac
cacttgggtctgagcgcaccgggcgaccgtactgctgctaagatcgagaaactgctggca
tggctggaaacgctgaaagctgaactgggtattccgaaatctatccgtgaagctggcgtt
caggaagcagacttcctggcgaacgtggataaactgtctgaagatgcattcgatgaccag
tgcaccggcgctaacccgcgttacccgctgatctccgagctgaaacagatcctgctggat
acctactacggtcgtgattatgtagaaggtgaaactgcagcgaaaaaagaagccgctccg
gctaaagctgagaaaaaagcgaaaaaatccgcttaa

DBGET integrated database retrieval system