KEGG   Escherichia coli BL21(DE3): B21_01244Help
Entry
B21_01244         CDS       T02096                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit, subunit of tryptophan synthase
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ebe  Escherichia coli BL21(DE3)
Pathway
ebe00260  Glycine, serine and threonine metabolism
ebe00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ebe01100  Metabolic pathways
ebe01110  Biosynthesis of secondary metabolites
ebe01130  Biosynthesis of antibiotics
ebe01230  Biosynthesis of amino acids
Module
ebe_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ebe00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    B21_01244 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    B21_01244 (trpA)
Enzymes [BR:ebe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     B21_01244 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth
Motif
Other DBs
NCBI-ProteinID: CAQ31761
UniProt: A0A140N9V2
Structure
PDB: 

Jmol
Position
complement(1302002..1302808)
Genome map
AA seq 268 aa AA seqDB search
MERYESLFAQLKERKEGAFVPFVTLGDPGIEQSLKIIDTLIEAGADALELGIPFSDPLAD
GPTIQNATLRAFAAGVTPAQCFEMLALIRQKHPTIPIGLLMYANLVFNKGIDEFYAQCEK
VGVDSVLVADVPVEESAPFRQAALRHNVAPIFICPPNADDDLLRQIASYGRGYTYLLSRA
GVTGAENRAALPLNHLVAKLKEYNAAPPLQGFGISAPDQVKAAIDAGAAGAISGSAIVKI
IEQHINEPEKMLAALKVFVQPMKAATRS
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggaacgctacgaatctctgtttgcccagttgaaggagcgcaaagaaggcgcattcgtt
cctttcgtcacgctcggtgatccgggcattgagcagtcattgaaaattatcgatacgcta
attgaagccggtgctgacgcgctggagttaggtatccccttctccgacccactggcggat
ggcccgacgattcaaaacgccactctgcgcgcctttgcggcaggtgtgactccggcacaa
tgttttgaaatgctggcactgattcgccagaaacacccgaccattcccattggcctgttg
atgtatgccaatctggtgtttaacaaaggcattgatgagttttatgcccagtgcgaaaaa
gtcggcgtcgattcggtgctggttgccgatgtgccagttgaagagtccgcgcccttccgc
caggccgcgttgcgtcataatgtcgcacctatcttcatctgcccgccaaatgccgatgac
gacctgctgcgccagatagcctcttacggtcgtggttacacctatttgctgtcacgagca
ggcgtgaccggcgcagaaaaccgcgccgcgttacccctcaatcatctggttgcgaagctg
aaagagtacaacgctgcacctccattgcagggatttggtatttccgccccggatcaggta
aaagcagcgattgatgcaggagctgcgggcgcgatttctggttcggccattgttaaaatc
atcgagcaacatattaatgagccagagaaaatgctggcggcactgaaagtttttgtacaa
ccgatgaaagcggcgacgcgcagttaa

DBGET integrated database retrieval system