KEGG   Escherichia coli BL21(DE3): B21_01245Help
Entry
B21_01245         CDS       T02096                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit, subunit of tryptophan synthase, beta subunit dimer and tryptophan synthase (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ebe  Escherichia coli BL21(DE3)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ebe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    B21_01245 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    B21_01245 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    B21_01245 (trpB)
Enzymes [BR:ebe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     B21_01245 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1302808..1304001)
Genome map
AA seq 397 aa AA seqDB search
MTTLLNPYFGEFGGMYVPQILMPALRQLEEAFVSAQKDPEFQAQFNDLLKNYAGRPTALT
KCQNITAGTNTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGAGQHGVASA
LASALLGLKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSATLKDACNEALRDWSGS
YETAHYMLGTAAGPHPYPTIVREFQRMIGEETKAQILEREGRLPDAVIACVGGGSNAIGM
FADFINETNVGLIGVEPGGHGIETGEHGAPLKHGRVGIYFGMKAPMMQTEDGQIEESYSI
SAGLDFPSVGPQHAYLNSTGRADYVSITDDEALEAFKTLCLHEGIIPALESSHALAHALK
MMRENLDKEQLLVVNLSGRGDKDIFTVHDILKARGEI
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgacaacattacttaacccctattttggtgagtttggcggcatgtacgtgccacaaatc
ctgatgcctgctctgcgccagctggaagaagcttttgtcagtgcgcaaaaagatcctgaa
tttcaggctcagttcaacgacctgctgaaaaactatgccgggcgtccaaccgcgctgacc
aaatgccagaacattacagccgggacgaacaccacgctgtatctcaagcgtgaagatttg
ctgcacggcggcgcgcataaaactaaccaggtgctggggcaggcgttgctggcgaagcgg
atgggtaaaaccgaaatcatcgccgaaaccggtgccggtcagcatggcgtggcgtcggcc
cttgccagcgccctgctcggcctgaaatgccgtatttatatgggtgccaaagacgttgaa
cgccagtcgcctaacgtttttcgtatgcgcttaatgggtgcggaagtgatcccggtgcat
agcggttccgcgacgctgaaagatgcctgtaacgaggcgctgcgcgactggtccggtagt
tacgaaaccgcgcactatatgctgggcaccgcagctggcccgcatccttatccgaccatt
gtgcgtgagtttcagcggatgattggcgaagaaaccaaagcgcagattctggaaagagaa
ggtcgcctgccggatgccgttatcgcctgtgttggcggcggttcgaatgccatcggcatg
tttgctgatttcatcaatgaaaccaacgtcggcctgattggtgtggagccaggtggtcac
ggtatcgaaactggcgagcacggcgcaccgctaaaacatggtcgcgtgggtatctatttc
ggtatgaaagcgccgatgatgcaaaccgaagacgggcagattgaagaatcttactccatc
tccgccggactggatttcccgtctgtcggcccacaacacgcgtatcttaacagcactgga
cgcgctgattacgtgtctattaccgatgatgaagcccttgaagccttcaaaacgctgtgc
ctgcacgaagggatcatcccggcgctggaatcctcccacgccctggcccatgcgttgaaa
atgatgcgcgaaaacctggataaagagcagctactggtggttaacctttccggtcgcggc
gataaagacatcttcaccgttcacgatattttgaaagcacgaggggaaatctga

DBGET integrated database retrieval system