KEGG   Escherichia coli BL21(DE3): B21_01346Help
Entry
B21_01346         CDS       T02096                                 

Gene name
ydfQ
Definition
Qin prophage, predicted lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
ebe  Escherichia coli BL21(DE3)
Brite
Enzymes [BR:ebe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     B21_01346 (ydfQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1404021..1404554
Genome map
AA seq 177 aa AA seqDB search
MNAKIRYGLSAAVLALIAVGAPAPDILDQFLDEKEGNHTTAYRDGSGIWTICRGATMVDG
KPVIPGMRLSKEKCDQVNAIERDKALAWVERNIKVPLTEPQKAGIASFCPYNIGPGKCFP
STFYKRLNAGDRKGACEAIRWWIKDGGRDCRIRSNNCYGQVIRRDQESALACWGIDQ
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcaaaaatcagatacggcctgtcggctgccgttctggcactgattgccgtcggt
gcgcctgcgcctgatattctcgaccagtttctggatgaaaaagaaggtaaccacacaacg
gcataccgcgatggttccggtatatggaccatctgtcgtggtgccacaatggtggatggt
aagcccgtcataccgggaatgaggctgtcgaaggaaaaatgcgaccaggttaacgctatt
gaacgtgataaggcgctggcatgggtggagcgcaatattaaagtaccactgaccgaacca
cagaaagcgggtatagcgtcattttgtccctataacattggccccggtaagtgtttcccg
tcgacgttttataagcggctgaatgccggtgatcgtaagggtgcatgcgaggcgattcgc
tggtggataaaagatggtgggcgcgattgccgcatacgttcaaataactgctatggacag
gttattcgtcgtgaccaggaaagcgcattagcctgttgggggatagatcagtga

DBGET integrated database retrieval system