KEGG   Escherichia coli BL21(DE3): B21_01565Help
Entry
B21_01565         CDS       T02096                                 

Gene name
folM
Definition
dihydrofolate reductase / dihydromonapterin reductase (EC:1.5.1.-)
Orthology
K13938  
dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.- 1.5.1.3]
Organism
ebe  Escherichia coli BL21(DE3)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ebe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    B21_01565 (folM)
   00670 One carbon pool by folate
    B21_01565 (folM)
Enzymes [BR:ebe01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     B21_01565 (folM)
    1.5.1.-  
     B21_01565 (folM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1626167..1626889
Genome map
AA seq 240 aa AA seqDB search
MGKTQPLPILITGGGRRIGLALAWHFINQKQPVIVSYRTHYPAIDGLINAGAQCIQADFS
TNDGVMAFADEVLKSTHGLRAILHNASAWMAEKPGAPLADVLACMMQIHVNTPYLLNHAL
ERLLRGHGHAASDIIHFTDYVVERGSDKHIAYAASKAALDNMTRSFARKLAPEVKVNSIA
PSLILFNEHDDAEYRQQALNKSLMKTAPGEKEVIDLVDYLLTSCFVTGRSFPLDGGRHLR
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaaacccagcccttgccaatattaattactggcggaggtcgtcgcatcggcctc
gccctcgcatggcatttcattaatcaaaagcaaccggtgattgtcagctatcggacacac
tatccagccattgatggactgattaatgcaggtgcgcagtgtattcaggctgatttttcg
accaacgacggtgtgatggcgtttgccgatgaagtactaaaaagcacccatggtctgcgt
gctattttgcataacgccagtgcgtggatggcggaaaaaccgggtgcgccactggccgac
gtactggcttgcatgatgcagatccacgttaataccccatacctgctcaaccatgcgctg
gaaagattactgcgtgggcacggacacgccgccagcgatatcattcactttaccgattat
gtggtggagcgcggtagcgacaaacatattgcgtatgctgcaagcaaagcggcactggat
aatatgacccgctcgtttgcccgcaagctggcaccggaagtgaaagtgaattctattgcg
ccatcgctgatcctgtttaatgaacatgatgatgccgaatatcgacaacaggcgctgaat
aaatcactgatgaaaaccgcgcctggcgagaaagaagtgatcgacctggtcgattactta
cttaccagttgctttgtcaccggacgcagtttcccacttgatggcggtcgtcatctgcgt
taa

DBGET integrated database retrieval system