KEGG   Escherichia coli BL21(DE3): B21_01908Help
Entry
B21_01908         CDS       T02096                                 

Gene name
hisD
Definition
histidinol dehydrogenase / histidinal dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
ebe  Escherichia coli BL21(DE3)
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ebe01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:ebe00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1986894..1988198
Genome map
AA seq 434 aa AA seqDB search
MSFNTIIDWNSCTAEQQRQLLMRPAISASESITRTVNDILDNVKTRGDEALREYSAKFDK
TTVTALKVSAEEIAAASERLSDELKQAMAVAVKNIETFHTAQKLPPVDVETQPGVRCQQV
TRPVASVGLYIPGGSAPLFSTVLMLATPARIAGCKKVVLCSPPPIADEILYAAQLCGVQD
VFNVGGAQAIAALAFGTESVPKVDKIFGPGNAFVTEAKRQVSQRLDGAAIDMPAGPSEVL
VIADSGATPDFVASDLLSQAEHGPDSQVILLTPDADMARRVAEAVERQLAELPRAETARQ
ALNASRLIVTKDLAQCVEISNQYGPEHLIIQTRNARELVDGITSAGSVFLGDWSPESAGD
YASGTNHVLPTYGYTATCSSLGLADFQKRMTVQELSKVGFSALASTIETLAAAERLTAHK
NAVTLRVNALKEQA
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgagctttaacacaatcattgactggaatagctgtactgcggagcaacaacgccagctg
ttaatgcgcccggcgatctccgcttctgaaagcattacccgcactgttaacgatattctc
gataacgtgaaaacgcgtggcgatgaggcccttcgggaatacagcgcgaagtttgataaa
accacggttaccgcgctgaaggtgtctgctgaggagatcgccgccgccagcgaacgcctg
agcgacgagctaaaacaggcgatggcggtggcagtaaagaatattgaaaccttccacact
gcgcaaaaactgccgccggtagatgtagaaacgcagccaggcgtacgttgccagcaagtc
acgcgtccggtagcttcagttgggttgtatattcctggcggctccgccccgctcttctca
acggtattaatgctggcaactccggcgcgtattgcgggctgtaaaaaagtggtgttgtgc
tcaccgccgccgattgccgatgagatcctttatgcggcgcagctgtgcggtgtgcaggac
gtgtttaacgtcggcggcgcacaggccattgccgcgctggcgtttggtacggaatctgtg
ccgaaagtggacaaaatcttcgggccgggtaacgcctttgtcaccgaagcaaaacgccag
gtaagccagcgtctggacggtgcggcgatcgatatgcccgcaggcccgtcggaagtgctg
gtgattgctgacagcggcgctacgccggatttcgtggcttctgatttgctttctcaggct
gaacacggcccggactcacaggtgattttactgacgcccgacgccgatatggcgcgtcgc
gttgccgaggctgtcgaacgccaactggcagaactgccgcgagctgaaaccgcccgccag
gcactgaacgccagccgcctgatcgtgactaaagatttagcgcagtgcgtagagatctcc
aaccagtacggcccggagcacctgatcattcagacccgcaacgcccgcgaactggtcgat
ggcatcaccagcgccggttcggtatttcttggtgactggtcaccggaatcggcaggcgac
tatgcctccggcaccaaccacgttctgccgacttacggttacaccgccacctgttccagc
ctcgggctggcggatttccagaagcgcatgaccgtgcaggaactgtcgaaagtaggtttc
tccgctctggcgtcgaccattgaaacactggccgccgccgagcgcctgaccgcccacaaa
aatgccgttactttgcgtgttaacgcccttaaggagcaagcatga

DBGET integrated database retrieval system