KEGG   Escherichia coli BL21(DE3): B21_01933Help
Entry
B21_01933         CDS       T02096                                 

Gene name
ybl99
Definition
ybl99 (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
ebe  Escherichia coli BL21(DE3)
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:ebe00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:ebe00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2008616..2009161)
Genome map
AA seq 181 aa AA seqDB search
MNVIKTEIPDVLIFEPKVFGDERGFFMESFNQKVFEEAVGRKVEFVQDNHSKSTKGVIRG
LHFQLPPYSQAKLVRCVVGEVYDVVVDIRKDSKTFGKWVGVNLSAENKRQLWIPEGFAHG
FEVISEVAHFLYKTNNYYNATMEKGIRWDDEYLAINWKEKKAIISEKDMKQPSFRELFEK
V
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtaattaaaactgaaattcctgatgtattaatatttgaaccaaaagtatttggg
gatgagcgtggtttttttatggaaagcttcaatcagaaagttttcgaagaagctgtgggg
cggaaggttgaatttgttcaggataaccattctaagtctactaaaggagtaattagagga
ttacattttcaattaccaccttattcacaggcaaaattagtacgctgtgtagtaggtgag
gtatatgacgttgttgttgatataaggaaagattctaaaacttttggcaaatgggtcggt
gtaaatctttctgctgaaaacaaacgacagttgtggattccagaaggattcgcccatggt
tttgaagtgattagtgaagttgctcattttttatacaaaacaaataattattataatgca
actatggaaaaaggtataagatgggatgatgaatatttagctattaattggaaagaaaaa
aaagcgataatctctgagaaagacatgaaacaaccatcattcagagaactttttgagaaa
gtttaa

DBGET integrated database retrieval system