KEGG   Escherichia coli BL21(DE3): B21_02558Help
Entry
B21_02558         CDS       T02096                                 

Gene name
pcm
Definition
L-isoaspartate protein carboxylmethyltransferase type II (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
ebe  Escherichia coli BL21(DE3)
Brite
Enzymes [BR:ebe01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     B21_02558 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2708855..2709481)
Genome map
AA seq 208 aa AA seqDB search
MVSRRVQALLDQLRAQGIQDEQVLNALAAVPREKFVDEAFEQKAWDNIALPIGQGQTISQ
PYMVARMTELLELTPQSRVLEIGTGSGYQTAILAHLVQHVCSVERIKGLQWQARRRLKNL
DLHNVSTRHGDGWQGWQARAPFDAIIVTAAPPEIPTALMTQLDEGGILVLPVGEEHQYLK
RVRRRGGEFIIDTVEAVRFVPLVKGELA
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcagacgcgtacaagcacttctggatcaattacgtgcgcaaggtattcaggat
gagcaggtgctgaatgcacttgccgccgtgccgcgtgaaaaattcgttgatgaagcgttt
gaacaaaaagcctgggacaatatcgctttgccgataggtcaggggcagacaatttcgcag
ccatatatggtggcgcgaatgaccgaattactcgagctgacgccgcagtcgcgggtgctg
gaaattggcaccggttcgggatatcaaacggcaatcctggcgcatcttgtccagcatgtt
tgctcggttgaacggattaaaggcttgcagtggcaggcacgtcgccgcctgaaaaatctt
gatttacataatgtttcaacccgtcatggcgatggatggcaaggttggcaggcacgtgcg
ccgtttgacgctatcattgttacggcggcaccgccggaaattccaactgcgctaatgacg
cagctggacgaaggcgggattctcgtcttacccgtaggggaggagcaccagtatttgaaa
cgggtgcgtcgtcggggaggcgaatttattatcgataccgtggaggccgtgcgctttgtc
cctttagtgaagggtgagctggcttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system