KEGG   Escherichia coli BL21(DE3): B21_03140Help
Entry
B21_03140         CDS       T02096                                 

Gene name
chiA
Definition
chitinase (EC:3.2.1.14)
Orthology
K13381  
bifunctional chitinase/lysozyme [EC:3.2.1.14 3.2.1.17]
Organism
ebe  Escherichia coli BL21(DE3)
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ebe00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    B21_03140 (chiA)
Enzymes [BR:ebe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.14  chitinase
     B21_03140 (chiA)
    3.2.1.17  lysozyme
     B21_03140 (chiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3327388..3329448)
Genome map
AA seq 686 aa AA seqDB search
MKLNIFTKSMIGMGLVCSALPALAMEAWNNQQGGNKYQVIFDGKIYENAWWVSSTNCPGK
AKANDATNPWRLKRTATAAEISQFGNTLSCEKSGSSSSSNSNTPASNTPANSEPSTPADS
GNDYSLQAWSGQEGSEIYHVIFNGNVYKNAWWVGSKDCPRGTSAENSNNPWRLERTATAA
ELSQYGNPTTCEIDNGGVIVADGFQASKAYSADSIVDYNDAHYKTSVDQDAWGFVPGGDN
PWKKYEPAKAWSASTVYVKGDRVVVDGQAYEALFWTQSDNPALVANQNATGSNSRPWKPL
GKAQSYSNEELNNAPQFNPETLYASDTLIRFNGVNYISQSKVQKVSPSDSNPWRVFVDWT
GTKERVGTPKKAWPKHVYAPYVDFTLNTIPDLAALAKNHNVNHFTLAFVVSKDANTCLPT
WGTAYGMHNYAQYSKIKALREAGGDVMLSIGGANNAPLAASCKNVDDLMQHYYDIVDNLN
LKVLDFDIEGTWVADQASIERRNLAVKKVQDKWKSEGKDIAIWYTLPILPTGLTPEGMNV
LSDAKAKGVELAGVNVMTMDYGNAICQSANTEGQNIHGKCATSAIANLHSQLKGLHPNKS
DAEIDAMMGTTPMVGVNDVQGEVFYLSDARLVMQDAQKRNLGMVGIWSIARDLPGGTNLS
PEFHGLTKEQAPKYAFSEIFAPFTKQ
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaaatatatttactaaatctatgattggtatggggctggtgtgttccgctctg
ccagcattggcaatggaagcatggaataaccaacaaggtggtaataaatatcaggttatt
ttcgatggcaaaatttatgaaaatgcctggtgggtttcttctacaaattgcccgggaaaa
gcgaaagcaaatgatgcaactaacccgtggcgtttaaagcgtaccgcaacagctgctgaa
attagtcagtttggcaatacactttcctgcgaaaagagcggcagctcatcttcttcaaat
tcaaatacgcctgcatccaatacgccggctaacagcgagccatcaacaccagcggatagc
ggtaacgattactcattgcaagcgtggagcggccaggaaggtagcgaaatttaccatgtt
attttcaatggtaatgtttacaagaacgcctggtgggttgggtctaaagattgcccacgg
ggtaccagcgctgaaaactccaataacccatggcgtctcgagcgtacagctaccgctgcg
gaattgagtcagtacggtaacccgactacctgtgaaattgataacggcggcgtcattgtt
gcggatggtttccaggccagcaaagcgtacagcgcggacagcatcgtagattataacgat
gcacattataaaacttctgtcgatcaagacgcatggggctttgtcccgggcggcgataac
ccgtggaagaaatacgaaccggcgaaagcatggtccgcatccactgtgtacgtgaaaggt
gatcgcgttgttgttgatgggcaggcttatgaagcgctgttctggacgcaaagtgacaac
cctgctctggtggcgaaccaaaacgccaccggtagcaatagccgcccgtggaagccgtta
ggtaaggctcagagctatagcaacgaagagctgaataatgcgccgcagtttaatccagaa
acgctttatgccagcgatacgctgattcgctttaacggtgtgaactacatttctcagagt
aaagtgcagaaagtttctccttctgacagcaacccgtggcgtgtttttgttgactggacc
ggaaccaaagaacgtgtaggtacgccgaagaaagcatggccgaaacacgtttatgcaccg
tatgttgactttacgctgaatacgatcccggatttggctgcgctggctaagaatcataac
gtcaaccacttcacgctggcatttgtggtgagtaaagatgcgaacacctgtctgccgaca
tggggtaccgcttatggtatgcacaattacgctcagtacagcaaaatcaaagctctgcgt
gaggctggcggcgatgtgatgctgtctatcggtggtgctaacaacgctccgctggctgct
tcctgtaagaacgtagacgatctgatgcagcattattatgacatcgttgataacctgaac
ctcaaagtcctggacttcgatatcgaaggcacctgggttgcggatcaggcatctattgaa
cgtcgtaaccttgctgtgaagaaagtgcaggataaatggaagtcagaaggcaaagatatt
gctatctggtacaccttgccaattctgccgactggcctgacgccggaagggatgaatgtc
ctgagcgatgccaaagcgaaaggtgttgagctggcgggtgtgaacgtgatgacaatggac
tacggtaacgcgatttgtcagtctgcaaataccgaaggccagaacattcacggtaagtgt
gcaacgtctgcgattgccaacctgcattcacaattgaaaggcctccatcccaataagagc
gatgcagaaattgacgctatgatgggtaccacgccgatggttggcgtgaacgacgttcag
ggcgaggtgttctatctctctgatgctcgtctggtcatgcaggatgcgcagaagcgtaat
ctcggtatggttggtatctggtcaatcgcgcgcgacctgccgggcggcactaacctgtct
ccggaattccacggcctgactaaagaacaggcaccgaagtacgcatttagcgaaatcttc
gcgccgtttactaagcaataa

DBGET integrated database retrieval system