KEGG   Escherichia coli BL21(DE3): B21_03140Help
Entry
B21_03140         CDS       T02096                                 

Gene name
chiA
Definition
chitinase (EC:3.2.1.14)
Orthology
K13381  
bifunctional chitinase/lysozyme [EC:3.2.1.14 3.2.1.17]
Organism
ebe  Escherichia coli BL21(DE3)
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ebe00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3327388..3329448)
Genome map
AA seq 686 aa AA seqDB search
MKLNIFTKSMIGMGLVCSALPALAMEAWNNQQGGNKYQVIFDGKIYENAWWVSSTNCPGK
AKANDATNPWRLKRTATAAEISQFGNTLSCEKSGSSSSSNSNTPASNTPANSEPSTPADS
GNDYSLQAWSGQEGSEIYHVIFNGNVYKNAWWVGSKDCPRGTSAENSNNPWRLERTATAA
ELSQYGNPTTCEIDNGGVIVADGFQASKAYSADSIVDYNDAHYKTSVDQDAWGFVPGGDN
PWKKYEPAKAWSASTVYVKGDRVVVDGQAYEALFWTQSDNPALVANQNATGSNSRPWKPL
GKAQSYSNEELNNAPQFNPETLYASDTLIRFNGVNYISQSKVQKVSPSDSNPWRVFVDWT
GTKERVGTPKKAWPKHVYAPYVDFTLNTIPDLAALAKNHNVNHFTLAFVVSKDANTCLPT
WGTAYGMHNYAQYSKIKALREAGGDVMLSIGGANNAPLAASCKNVDDLMQHYYDIVDNLN
LKVLDFDIEGTWVADQASIERRNLAVKKVQDKWKSEGKDIAIWYTLPILPTGLTPEGMNV
LSDAKAKGVELAGVNVMTMDYGNAICQSANTEGQNIHGKCATSAIANLHSQLKGLHPNKS
DAEIDAMMGTTPMVGVNDVQGEVFYLSDARLVMQDAQKRNLGMVGIWSIARDLPGGTNLS
PEFHGLTKEQAPKYAFSEIFAPFTKQ
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaaatatatttactaaatctatgattggtatggggctggtgtgttccgctctg
ccagcattggcaatggaagcatggaataaccaacaaggtggtaataaatatcaggttatt
ttcgatggcaaaatttatgaaaatgcctggtgggtttcttctacaaattgcccgggaaaa
gcgaaagcaaatgatgcaactaacccgtggcgtttaaagcgtaccgcaacagctgctgaa
attagtcagtttggcaatacactttcctgcgaaaagagcggcagctcatcttcttcaaat
tcaaatacgcctgcatccaatacgccggctaacagcgagccatcaacaccagcggatagc
ggtaacgattactcattgcaagcgtggagcggccaggaaggtagcgaaatttaccatgtt
attttcaatggtaatgtttacaagaacgcctggtgggttgggtctaaagattgcccacgg
ggtaccagcgctgaaaactccaataacccatggcgtctcgagcgtacagctaccgctgcg
gaattgagtcagtacggtaacccgactacctgtgaaattgataacggcggcgtcattgtt
gcggatggtttccaggccagcaaagcgtacagcgcggacagcatcgtagattataacgat
gcacattataaaacttctgtcgatcaagacgcatggggctttgtcccgggcggcgataac
ccgtggaagaaatacgaaccggcgaaagcatggtccgcatccactgtgtacgtgaaaggt
gatcgcgttgttgttgatgggcaggcttatgaagcgctgttctggacgcaaagtgacaac
cctgctctggtggcgaaccaaaacgccaccggtagcaatagccgcccgtggaagccgtta
ggtaaggctcagagctatagcaacgaagagctgaataatgcgccgcagtttaatccagaa
acgctttatgccagcgatacgctgattcgctttaacggtgtgaactacatttctcagagt
aaagtgcagaaagtttctccttctgacagcaacccgtggcgtgtttttgttgactggacc
ggaaccaaagaacgtgtaggtacgccgaagaaagcatggccgaaacacgtttatgcaccg
tatgttgactttacgctgaatacgatcccggatttggctgcgctggctaagaatcataac
gtcaaccacttcacgctggcatttgtggtgagtaaagatgcgaacacctgtctgccgaca
tggggtaccgcttatggtatgcacaattacgctcagtacagcaaaatcaaagctctgcgt
gaggctggcggcgatgtgatgctgtctatcggtggtgctaacaacgctccgctggctgct
tcctgtaagaacgtagacgatctgatgcagcattattatgacatcgttgataacctgaac
ctcaaagtcctggacttcgatatcgaaggcacctgggttgcggatcaggcatctattgaa
cgtcgtaaccttgctgtgaagaaagtgcaggataaatggaagtcagaaggcaaagatatt
gctatctggtacaccttgccaattctgccgactggcctgacgccggaagggatgaatgtc
ctgagcgatgccaaagcgaaaggtgttgagctggcgggtgtgaacgtgatgacaatggac
tacggtaacgcgatttgtcagtctgcaaataccgaaggccagaacattcacggtaagtgt
gcaacgtctgcgattgccaacctgcattcacaattgaaaggcctccatcccaataagagc
gatgcagaaattgacgctatgatgggtaccacgccgatggttggcgtgaacgacgttcag
ggcgaggtgttctatctctctgatgctcgtctggtcatgcaggatgcgcagaagcgtaat
ctcggtatggttggtatctggtcaatcgcgcgcgacctgccgggcggcactaacctgtct
ccggaattccacggcctgactaaagaacaggcaccgaagtacgcatttagcgaaatcttc
gcgccgtttactaagcaataa

DBGET integrated database retrieval system