KEGG   Escherichia coli BL21(DE3): B21_03846Help
Entry
B21_03846         CDS       T02096                                 

Gene name
aceB
Definition
(RefSeq) malate synthase A (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
ebe  Escherichia coli BL21(DE3)
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ebe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    B21_03846 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    B21_03846 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    B21_03846 (aceB)
Enzymes [BR:ebe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     B21_03846 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4123357..4124958
Genome map
AA seq 533 aa AA seqDB search
MTEQATTTDELAFTRPYGEQEKQILTAEAVEFLTELVTHFTPQRNKLLAARIQQQQDIDN
GTLPDFISETASIRNADWKIRGIPADLEDRRVEITGPVERKMVINALNANVKVFMADFED
SLAPDWNKVIDGQINLRDAVNGTISYTNEAGKIYQLKPNPAVLICRVRGLHLPEKHVTWR
GEAIPGSLFDFALYFFHNYQALLAKGSGPYFYLPKTQSWQEAAWWSEVFSYAEDRFNLPR
GTIKATLLIETLPAVFQMDEILHALRDHIVGLNCGRWDYIFSYIKTLKNYPDRVLPDRQA
VTMDKPFLNAYSRLLIKTCHKRGAFAMGGMAAFIPSKDEEHNNQVLNKVKADKSLEANNG
HDGTWIAHPGLADTAMAVFNDILGSRKNQLEVMREQDAPITADQLLAPCDGERTEEGMRA
NIRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIWQWIHHQKTLSNGKPVTKALFR
QMLGEEMKVIASELGEERFSQGRFDDAARLMEQITTSDELIDFLTLPGYRLLA
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgactgaacaggcaacaacaaccgatgaactggctttcacaaggccgtatggcgagcag
gagaagcaaattcttactgccgaagcggtagaatttctgactgagctggtgacgcatttt
acgccacaacgcaataaacttctggcagcgcgcattcagcagcagcaagatattgataac
ggaacgttgcctgattttatttcggaaacagcttccattcgcaatgctgattggaaaatt
cgcgggattcctgcggacttagaagaccgccgcgtagagataactggcccggtagagcgc
aagatggtgatcaacgcgctcaacgccaatgtgaaagtctttatggccgatttcgaagat
tcactggcaccagactggaacaaagtgatcgacgggcaaattaacctgcgtgatgcggtt
aacggcaccatcagttacactaatgaagcaggcaaaatttaccagctcaagcccaatcca
gcggttttgatttgtcgggtacgcggtctgcacttgccggaaaaacatgtcacctggcgt
ggtgaggcaatccccggcagcctgtttgattttgcgctctatttcttccacaactatcag
gcactgttggcaaagggcagtggtccctatttctatctgccgaaaacccagtcctggcag
gaagcggcctggtggagcgaagtcttcagctatgcagaagatcgctttaatctgccgcgc
ggcaccatcaaggcgacgttgctgattgaaacgctgcccgccgtgttccagatggatgaa
atccttcacgcgctgcgtgaccatattgttggtctgaactgcggtcgttgggattacatc
ttcagctatatcaaaacgttgaaaaactatcccgatcgcgtcctgccagacagacaggca
gtgacgatggataaaccattcctgaatgcttactcacgcctgttgattaaaacctgccat
aaacgcggtgcttttgcgatgggcggcatggcggcgtttattccgagcaaagatgaagag
cacaataaccaggtgctcaacaaagtaaaagcggataaatcgctggaagccaataacggt
cacgatggcacatggatcgctcacccaggccttgcggacacggcaatggcggtattcaac
gacattctcggctcccgtaaaaatcagcttgaagtgatgcgcgaacaagacgcgccgatt
actgccgatcagctgctggcaccttgtgatggtgaacgcaccgaagaaggtatgcgcgcc
aacattcgcgtggctgtgcagtacatcgaagcgtggatctctggcaacggctgtgtgccg
atttatggcctgatggaagatgcggcgacggctgaaatttcccgtacctcgatctggcag
tggatccatcatcaaaaaacgttgagcaatggcaaaccggtgaccaaagccttgttccgc
cagatgctgggcgaagagatgaaagtcattgccagcgaactgggcgaagaacgtttctcc
caggggcgttttgacgatgccgcacgcttgatggaacagatcaccacttccgatgagtta
attgatttcctgaccctgccaggctaccgcctgttagcgtaa

DBGET integrated database retrieval system