KEGG   Escherichia coli BL21(DE3): B21_03847Help
Entry
B21_03847         CDS       T02096                                 

Gene name
aceA
Definition
isocitrate lyase monomer, subunit of isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
ebe  Escherichia coli BL21(DE3)
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ebe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    B21_03847 (aceA)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    B21_03847 (aceA)
Enzymes [BR:ebe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     B21_03847 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
4124988..4126292
Genome map
AA seq 434 aa AA seqDB search
MKTRTQQIEELQKEWTQPRWEGITRPYSAEDVVKLRGSVNPECTLAQLGAAKMWRLLHGE
SKKGYINSLGALTGGQALQQAKAGIEAVYLSGWQVAADANLAASMYPDQSLYPANSVPAV
VERINNTFRRADQIQWSAGIEPGDPRYVDYFLPIVADAEAGFGGVLNAFELMKAMIEAGA
AAVHFEDQLASVKKCGHMGGKVLVPTQEAIQKLVAARLAADVTGVPTLLVARTDADAADL
ITSDCDPYDSEFITGERTSEGFFRTHAGIEQAISRGLAYAPYADLVWCETSTPDLELARR
FAQAIHAKYPGKLLAYNCSPSFNWQKNLDDKTIASFQQQLSDMGYKFQFITLAGIHSMWF
NMFDLANAYAQGEGMKHYVEKVQQPEFAAAKDGYTFVSHQQEVGTGYFDKVTTIIQGGTS
SVTALTGSTEESQF
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacccgtacacaacaaattgaagaattacagaaagagtggactcaaccgcgttgg
gaaggcattactcgcccatacagtgcggaagatgtggtgaaattacgcggttcagtcaat
cctgaatgcacgctggcgcaactgggcgcagcgaaaatgtggcgtctgctgcacggtgag
tcgaaaaaaggctacatcaacagcctcggcgcactgactggcggtcaggcgctgcaacag
gcgaaagcgggtattgaagcagtctatctgtcgggatggcaggtagcggcggacgctaac
ctggcggccagcatgtatccggatcagtcgctctatccggcaaactcggtgccagctgtg
gtggagcggatcaacaacaccttccgtcgtgccgatcagatccaatggtccgcgggcatt
gagccgggcgatccgcgctatgtcgattacttcctgccgatcgttgccgatgcggaagcc
ggttttggcggtgtcctgaatgcctttgaactgatgaaagcgatgattgaagccggtgca
gcggcagttcacttcgaagatcagctggcgtcagtgaagaaatgcggtcacatgggcggc
aaagttttagtgccaactcaggaagctattcagaaactggtcgcggcgcgtctggcagct
gacgtgacgggcgttccaaccctgctggttgcccgtaccgatgctgatgcggcggatctg
attacctccgattgcgacccgtatgacagtgaatttattactggcgagcgtaccagtgaa
ggcttcttccgtactcatgcgggcattgagcaagcgatcagccgtggcctggcgtatgcg
ccatatgctgacctggtctggtgtgaaacctccacgccggatctggaactggcgcgtcgc
tttgcacaagctatccacgcgaaatatccgggcaaactgctggcttataactgctcgccg
tcgttcaactggcagaaaaacctcgacgacaaaactattgccagcttccagcagcagctg
tcggatatgggctacaagttccagttcatcaccctggcaggtatccacagcatgtggttc
aacatgtttgacctggcaaacgcctatgcccagggcgagggtatgaagcactacgttgag
aaagtgcagcagccggaatttgccgccgcgaaagatggctataccttcgtatctcaccag
caggaagtgggtacaggttacttcgataaagtgacgactattattcagggcggcacgtcg
tcggttacagcgctgaccggctccaccgaagaatcgcagttctaa

DBGET integrated database retrieval system